BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0700 (693 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 26 1.3 AF515525-1|AAM61892.1| 235|Anopheles gambiae glutathione S-tran... 23 9.1 AF457562-1|AAL68792.1| 78|Anopheles gambiae hypothetical prote... 23 9.1 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.8 bits (54), Expect = 1.3 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -2 Query: 485 ISKLGRSNSLSHHFRNTETSSLVHSLGSGGRP 390 I+ L S S+ + + N S+ + G+GG P Sbjct: 2050 INTLNTSYSIDYEYENDNLRSIKYPFGAGGEP 2081 >AF515525-1|AAM61892.1| 235|Anopheles gambiae glutathione S-transferase protein. Length = 235 Score = 23.0 bits (47), Expect = 9.1 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = -3 Query: 604 ASRTSI*RTLCKTSPAPGHLSPK-SVLVSKHNAYRSFERGPYQN*VDRILFH 452 A +I R LC+ P GH P +V ++ + Y S++ + V FH Sbjct: 68 AESVAIYRYLCREFPTDGHWYPSDTVRQARVDEYLSWQHLNLRADVSLYFFH 119 >AF457562-1|AAL68792.1| 78|Anopheles gambiae hypothetical protein 15 protein. Length = 78 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = -2 Query: 464 NSLSHHFRNTETSSLVHSLGSGGRPA 387 N++++ ++ + S+ HSLG+G R A Sbjct: 39 NTIANKSKDKKASAPKHSLGTGARMA 64 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 728,101 Number of Sequences: 2352 Number of extensions: 14440 Number of successful extensions: 35 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -