BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0700 (693 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC006670-2|ABC71822.1| 901|Caenorhabditis elegans Patched relat... 29 3.2 U41104-5|AAK18976.3| 1564|Caenorhabditis elegans Twik family of ... 28 5.5 U55369-10|AAK52180.2| 389|Caenorhabditis elegans Hypothetical p... 27 9.6 >AC006670-2|ABC71822.1| 901|Caenorhabditis elegans Patched related family protein12, isoform a protein. Length = 901 Score = 29.1 bits (62), Expect = 3.2 Identities = 19/70 (27%), Positives = 35/70 (50%) Frame = +2 Query: 116 YTEFCANFCDDNVRVLSCPVSVFNKDFDNATSSGSA*PINVMKVVSYNCRLGPVWSGYRY 295 Y EFC NFC N + S + + DN+ + ++ + +S N + ++S R Sbjct: 142 YQEFCTNFCQINEPFVQFARS-YLTELDNSKNG-----TDLSERISLNYPITSIYS--RK 193 Query: 296 HSVQQNYYGV 325 S+Q N++G+ Sbjct: 194 MSIQPNFFGI 203 >U41104-5|AAK18976.3| 1564|Caenorhabditis elegans Twik family of potassium channelsprotein 2 protein. Length = 1564 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -1 Query: 651 ERWE*QVRKELYLTALRRVQAFEEHYVRH 565 E W+ + KEL L + + +AF+E YVR+ Sbjct: 15 EVWKEDIEKELMLYSEKLYKAFKEQYVRY 43 >U55369-10|AAK52180.2| 389|Caenorhabditis elegans Hypothetical protein C18C4.9 protein. Length = 389 Score = 27.5 bits (58), Expect = 9.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +2 Query: 41 AGLRRAVTRHVWRDHRRYAC 100 AGLR A +HVW +Y C Sbjct: 277 AGLREAGEKHVWPTRNQYGC 296 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,539,389 Number of Sequences: 27780 Number of extensions: 317291 Number of successful extensions: 878 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 841 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 878 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1592382278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -