BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0694 (564 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 23 2.4 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 22 4.2 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 9.6 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 9.6 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 9.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 9.6 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 22.6 bits (46), Expect = 2.4 Identities = 19/91 (20%), Positives = 36/91 (39%), Gaps = 3/91 (3%) Frame = +2 Query: 221 HKYEEFQRRS---LSIKDEYVLQKSNIIEEKSYNLEKRKLDESSASFDDNNLEFEKTTVD 391 HK +E ++ + + V++K E E+ K +E D + + E D Sbjct: 194 HKIKEIVKKHSQFIGYPIKLVVEKEREKELSDDEAEEEKKEEEGEDKDKDKPKIEDVGED 253 Query: 392 ITEDKNDSKTKKRGQNKSRPKIFKDGKESKP 484 ED KK+ K + ++ ++KP Sbjct: 254 EDEDTKKEDKKKKKTIKEKYTEDEELNKTKP 284 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.8 bits (44), Expect = 4.2 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -1 Query: 504 TSRTVGHGLLSLPSLNIFGRDLFWP 430 +SR+V S+P+ +G DL++P Sbjct: 97 SSRSVMTSCSSVPTTASYGSDLYFP 121 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.6 bits (41), Expect = 9.6 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 127 SYFYNIISTTVFMIM 83 S++YNII FM++ Sbjct: 946 SFYYNIIPILFFMLV 960 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.6 bits (41), Expect = 9.6 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 127 SYFYNIISTTVFMIM 83 S++YNII FM++ Sbjct: 946 SFYYNIIPILFFMLV 960 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.6 bits (41), Expect = 9.6 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 127 SYFYNIISTTVFMIM 83 S++YNII FM++ Sbjct: 946 SFYYNIIPILFFMLV 960 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.6 bits (41), Expect = 9.6 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -3 Query: 127 SYFYNIISTTVFMIM 83 S++YNII FM++ Sbjct: 946 SFYYNIIPILFFMLV 960 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,082 Number of Sequences: 336 Number of extensions: 2298 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13890653 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -