BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0694 (564 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 24 0.92 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 23 2.8 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 23 2.8 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 22 3.7 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 4.9 DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. 21 8.6 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 21 8.6 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 21 8.6 AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 21 8.6 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 21 8.6 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 21 8.6 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 8.6 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 21 8.6 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 24.2 bits (50), Expect = 0.92 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +2 Query: 266 EYVLQKSNIIEEKSYNLEKRKLDESSASFDDNNLE 370 E +++K N+++E EK D A DDN + Sbjct: 64 ECMMKKFNVVDENGNFNEKNTRDIVQAVLDDNETD 98 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.6 bits (46), Expect = 2.8 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -1 Query: 468 PSLNIFGRDLFWPRFLVLESFLSSVMSTVVF 376 PS+ + R +F+ +L+ SF+ + S V F Sbjct: 360 PSMANYDRGVFYKNYLLNVSFIDAAGSEVKF 390 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.6 bits (46), Expect = 2.8 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -1 Query: 468 PSLNIFGRDLFWPRFLVLESFLSSVMSTVVF 376 PS+ + R +F+ +L+ SF+ + S V F Sbjct: 450 PSMANYDRGVFYKNYLLNVSFIDAAGSEVKF 480 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -1 Query: 561 VMDKLTIIILTNFQ 520 V+DKL I+L NFQ Sbjct: 317 VLDKLARIVLLNFQ 330 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.8 bits (44), Expect = 4.9 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +2 Query: 218 THKYEEFQRRSLSIKDEYVLQKSNIIEEKSYNLEK 322 ++ EFQ+R ++ L+ +IEE+S E+ Sbjct: 201 SYSLTEFQQRRAFLETRQSLEVQLVIEEQSTEQER 235 >DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. Length = 135 Score = 21.0 bits (42), Expect = 8.6 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = +2 Query: 266 EYVLQKSNIIEEKSYNLEKRKLDESSASFDDNNLE 370 E ++K N+++E + EK D A +DN + Sbjct: 64 ECTMKKFNVVDENANFNEKISSDIVRAVLNDNEAD 98 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.0 bits (42), Expect = 8.6 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 32 YNSYKITLKLSEKITLVHNHKNSGRNYIIEI 124 YN+Y + +N+K +NYII I Sbjct: 94 YNNYNNNYNNNYNNNYNNNYKKLYKNYIINI 124 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.0 bits (42), Expect = 8.6 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 32 YNSYKITLKLSEKITLVHNHKNSGRNYIIEI 124 YN+Y + +N+K +NYII I Sbjct: 94 YNNYNNNYNNNYNNNYNNNYKKLYKNYIINI 124 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 353 DDNNLEFEKTTVDITEDKND 412 DD N E ++ V IT+D+ D Sbjct: 32 DDENCETLQSEVHITKDEYD 51 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -1 Query: 489 GHGLLSLPSLNIFGRDLFW 433 G G + + S FGR+ FW Sbjct: 529 GPGKIQMDSSTNFGREDFW 547 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 353 DDNNLEFEKTTVDITEDKND 412 DD N E ++ V IT+D+ D Sbjct: 32 DDENCETLQSEVHITKDEYD 51 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.0 bits (42), Expect = 8.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 398 EDKNDSKTKKRGQNKSRPKI 457 EDK D+ K+ +NKS P I Sbjct: 37 EDKLDNLMDKQFKNKSLPVI 56 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 21.0 bits (42), Expect = 8.6 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = -1 Query: 489 GHGLLSLPSLNIFGRDLFW 433 G G + + S FGR+ FW Sbjct: 529 GPGKIQMDSSTNFGREDFW 547 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,048 Number of Sequences: 438 Number of extensions: 2295 Number of successful extensions: 15 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16317903 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -