BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0693 (749 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32904| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_44872| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_23756| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 28 9.3 >SB_32904| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 477 Score = 29.5 bits (63), Expect = 3.0 Identities = 21/80 (26%), Positives = 37/80 (46%) Frame = -3 Query: 255 TYKFVCNKSGIISEITFGVPYLVANCVVILRASVFPLAAFRSNSNARVLSCINVGITHGI 76 +++F ++ + I F VPY+ +S ++ SNSN+ S + + G Sbjct: 92 SWRFKSSRMFVYILIAFLVPYVTCTSSSSSNSSRSSSSSSNSNSNSSSSSSSSSSSSSGS 151 Query: 75 STFSNFVVNNKSKSDIQSSS 16 S+ SN N+ S S S+S Sbjct: 152 SSSSNSNSNSNSNSSSSSNS 171 >SB_44872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 908 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = -3 Query: 684 ALAGKVISFCMFLVSCFLIQTLQQKLNKSLCVNFSSLLLD 565 +LA KV+SFC + +QTL + L +L N +S +D Sbjct: 172 SLASKVMSFCFKVYGTSYLQTLLEPLVSNLVKNTTSFEVD 211 >SB_23756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -1 Query: 491 PIPKHLHLKQCFQISIKSSSLITGHTGNKFTAFKHLS 381 P KH+ LKQC +S+KS ++ F H++ Sbjct: 511 PRLKHVELKQCPAVSVKSEEILIEKCPEVFVEIIHMT 547 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +3 Query: 321 ACGSFVTISTCRLSLNGNSKRKMLKCCKL 407 ACG+ V+I+ C L N ++CC L Sbjct: 648 ACGNSVSITVCVRHLRENVNNSKIRCCFL 676 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,333,650 Number of Sequences: 59808 Number of extensions: 419800 Number of successful extensions: 1014 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 962 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1014 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -