BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0693 (749 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 26 1.4 AF457547-1|AAL68777.1| 163|Anopheles gambiae selenoprotein prot... 24 5.8 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 7.6 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 25.8 bits (54), Expect = 1.4 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 Query: 334 LSPFQRADYPLTETQKERCLN 396 L P + YP + QKE C+N Sbjct: 117 LKPIETCQYPFSAKQKEVCIN 137 >AF457547-1|AAL68777.1| 163|Anopheles gambiae selenoprotein protein. Length = 163 Score = 23.8 bits (49), Expect = 5.8 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +1 Query: 418 CPVIKDDDLIEIWKHCFRC 474 C + D LIE+ +HC C Sbjct: 41 CSSLSDYGLIELKEHCLEC 59 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/45 (24%), Positives = 22/45 (48%) Frame = -3 Query: 702 FFVIIIALAGKVISFCMFLVSCFLIQTLQQKLNKSLCVNFSSLLL 568 +F+ ++ GK FL+ CF+ + + + L +NF + L Sbjct: 16 YFLFVVRGTGKPFLPTSFLIYCFVSPSCLECSSVPLFINFIFMFL 60 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 730,799 Number of Sequences: 2352 Number of extensions: 14586 Number of successful extensions: 18 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -