BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0693 (749 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 23 2.3 AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 23 3.1 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 5.3 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 22 7.1 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 7.1 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 7.1 AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 21 9.3 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.3 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.3 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 9.3 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 23.4 bits (48), Expect = 2.3 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +1 Query: 289 NPPTSLICAAWRAVLLSPFQRADYPLTETQKE--RCL 393 +P SL+C+ +V SP ++ PLT +++ +CL Sbjct: 29 DPVKSLVCSPDLSVFTSPACGSETPLTNIEEKTYQCL 65 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = +1 Query: 427 IKDDDLIEIWKHCFRCKCLGIGCLTLPL*LLKRDKDYQN 543 +++D++++ WK F LG+ C+ + L + K N Sbjct: 100 LQNDEVLD-WKKIFDINLLGLTCMIQEVLKLMKKKGINN 137 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/26 (30%), Positives = 19/26 (73%) Frame = -3 Query: 117 RVLSCINVGITHGISTFSNFVVNNKS 40 R + +++ + + IST ++FV+NN++ Sbjct: 337 RKMQEMSIEVPYWISTTTSFVLNNRA 362 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.8 bits (44), Expect = 7.1 Identities = 9/28 (32%), Positives = 18/28 (64%), Gaps = 3/28 (10%) Frame = -3 Query: 708 SGFFVIIIALAGKVISFCM---FLVSCF 634 S FVI +A++ ++ FCM +++C+ Sbjct: 87 SNLFVINLAISNFLMMFCMSPPMVINCY 114 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.8 bits (44), Expect = 7.1 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +1 Query: 259 VLVLLLKSASNPPTSLICAAWRAVLLSPF 345 V+ LLL S PPTSL+ LL F Sbjct: 276 VVFLLLVSKILPPTSLVLPLIAKYLLFTF 304 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -2 Query: 556 SIFNNSGNPCL 524 S+FN+SGNP L Sbjct: 363 SMFNDSGNPIL 373 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/28 (32%), Positives = 18/28 (64%), Gaps = 3/28 (10%) Frame = -3 Query: 708 SGFFVIIIALAGKVISFCM---FLVSCF 634 S FVI +A++ ++ FCM +++C+ Sbjct: 53 SNLFVINLAISDFLMMFCMSPPMVINCY 80 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 9.3 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 204 GVPYLVANCVVILRASVFPLAAFRSNSNARVLSCI 100 GV ++ N ++L FP AAFR + ++ C+ Sbjct: 77 GVRRVLRNGTLVLLP--FPAAAFRQDVHSAAYRCV 109 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 9.3 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 204 GVPYLVANCVVILRASVFPLAAFRSNSNARVLSCI 100 GV ++ N ++L FP AAFR + ++ C+ Sbjct: 77 GVRRVLRNGTLVLLP--FPAAAFRQDVHSAAYRCV 109 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 9.3 Identities = 5/11 (45%), Positives = 9/11 (81%) Frame = +1 Query: 445 IEIWKHCFRCK 477 +E W+H F+C+ Sbjct: 427 VEFWEHHFQCR 437 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,660 Number of Sequences: 438 Number of extensions: 3917 Number of successful extensions: 14 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -