BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= e40h0690
(649 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 7.8
AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 21 7.8
>EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein.
Length = 570
Score = 21.4 bits (43), Expect = 7.8
Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 2/34 (5%)
Frame = -2
Query: 549 RTVSRTLCDLSCNQESVGHGLLVIRG--GDVVPQ 454
R + + L DL C+ + L VIRG D +P+
Sbjct: 71 RFLLQCLEDLDCSLRKLNSRLFVIRGQPADALPK 104
>AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate
dehydrogenase protein.
Length = 363
Score = 21.4 bits (43), Expect = 7.8
Identities = 6/10 (60%), Positives = 9/10 (90%)
Frame = -2
Query: 180 VVSCGEGFVD 151
+V+CG GF+D
Sbjct: 208 IVACGAGFID 217
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 194,497
Number of Sequences: 438
Number of extensions: 4436
Number of successful extensions: 6
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19560480
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -