BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0689 (713 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 62 1e-11 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 62.5 bits (145), Expect = 1e-11 Identities = 29/67 (43%), Positives = 46/67 (68%), Gaps = 1/67 (1%) Frame = +3 Query: 282 IPDNIQLADPTFDVSSDIDLLLGADIFWDLLEQGRIRLPSG-PFLLNTKLGWVVSGPICS 458 +P +++LADPTF ID+L+GAD F ++++ +I+L P LL T+LGW+VSG Sbjct: 542 LPKDVRLADPTFHERGSIDMLIGADTFVEMIKAKKIKLDHELPTLLETELGWIVSG--AY 599 Query: 459 NHSNINE 479 H+N+N+ Sbjct: 600 KHNNLNQ 606 Score = 61.3 bits (142), Expect = 3e-11 Identities = 32/86 (37%), Positives = 53/86 (61%) Frame = +1 Query: 4 DQNNRYHVARALLDNGSQHSLISEKLAKRLNTNFTQSTVRIAGVGQHLTHTNKSCVISMR 183 D N++ + RALLDNGSQ + I+E++A+ L + + +IAGVG + S V ++R Sbjct: 449 DVNDQPYKVRALLDNGSQLNFITERVAQELRLKRARVSEQIAGVGGAIMRVAGSVVGTIR 508 Query: 184 SKTSNFNKRISCLVLPQITSSLPIQT 261 S T+ + + L+LP+I + LP +T Sbjct: 509 SLTTEYTTCLEFLILPKIATDLPSET 534 Score = 25.4 bits (53), Expect = 1.8 Identities = 11/36 (30%), Positives = 22/36 (61%) Frame = +2 Query: 515 LRKFWEIEDLSVSKNILTQDENKCEKLFIDTTKREK 622 + F+ IE++ +N+ +E +CE F TT+R++ Sbjct: 625 MNTFFNIEEVQ-DQNLWNVEERECEDHFQATTRRDE 659 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 754,557 Number of Sequences: 2352 Number of extensions: 15854 Number of successful extensions: 25 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -