BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0689 (713 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 24 1.6 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 24 1.6 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 23 2.2 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 23 3.8 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 8.8 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 23.8 bits (49), Expect = 1.6 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = +3 Query: 417 NTKLGWVVSGPICSNHSNINEVQCNFSHSLDYNFVSFGK*KIYLCQRI 560 N L VVS PI + + V C SHS V+ G I LC+++ Sbjct: 203 NVPLQPVVSDPIFDKKAMSDLVICKLSHS--NASVAGGMEMILLCEKV 248 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 23.8 bits (49), Expect = 1.6 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = +3 Query: 417 NTKLGWVVSGPICSNHSNINEVQCNFSHSLDYNFVSFGK*KIYLCQRI 560 N L VVS PI + + V C SHS V+ G I LC+++ Sbjct: 203 NVPLQPVVSDPIFDKKAMSDLVICKLSHS--NASVAGGMEMILLCEKV 248 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 23.4 bits (48), Expect = 2.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 Query: 86 ND*IRILHSPLFE*QVWVNISHIRINHVLF 175 ND I HS + WVN S IR N+ LF Sbjct: 259 NDRILYFHSLASRVESWVNTSVIR-NYTLF 287 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 22.6 bits (46), Expect = 3.8 Identities = 13/38 (34%), Positives = 17/38 (44%), Gaps = 5/38 (13%) Frame = -3 Query: 192 CFRTHR-----NNT*FIRMCEMLTHTCYSNSGLCKIRI 94 C R HR N + CE+ C+S S L K R+ Sbjct: 110 CPRRHRPVCASNGKIYANHCELHRAACHSGSSLTKSRL 147 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 8.8 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -3 Query: 387 SYPVPKDPKIYQHRVINLCLMIHRKWDLL 301 S+PV K+ + V+ +M+H + D L Sbjct: 104 SWPVKKEAVVEGDLVLGGLMMVHERQDRL 132 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,472 Number of Sequences: 438 Number of extensions: 4342 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22048515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -