BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0682 (477 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces... 25 7.9 SPCC794.10 |||UTP-glucose-1-phosphate uridylyltransferase |Schiz... 25 7.9 >SPAC6F6.06c |rax2||cell polarity factor Rax2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1155 Score = 24.6 bits (51), Expect = 7.9 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -2 Query: 395 WCYFDTNAISWLNIIH-CCSVQVSLALPLNFVFEN 294 +C F+ N+ SW NI H S +V L +N + + Sbjct: 887 FCIFEYNSSSWRNISHNLISAEVQSILWVNETYSS 921 >SPCC794.10 |||UTP-glucose-1-phosphate uridylyltransferase |Schizosaccharomyces pombe|chr 3|||Manual Length = 499 Score = 24.6 bits (51), Expect = 7.9 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -2 Query: 389 YFDTNAISWLNIIHCCSVQVSLALPLNFVFEN 294 YF N I NI+ S L +P N V EN Sbjct: 456 YFGRNVILKGNIVIVASENTILCIPSNAVLEN 487 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,796,870 Number of Sequences: 5004 Number of extensions: 31168 Number of successful extensions: 51 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 184476110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -