BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0682 (477 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 1.8 AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 25 1.8 AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CY... 22 9.6 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 130 KFKFVIGISLIKLKFHLF 183 K FV+G L+K K+HL+ Sbjct: 974 KDSFVLGYRLVKKKYHLY 991 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 24.6 bits (51), Expect = 1.8 Identities = 12/31 (38%), Positives = 21/31 (67%) Frame = +1 Query: 130 KFKFVIGISLIKLKFHLFSLEMCPLESVLLI 222 K + +G++++ LK + FSLE C ++ LLI Sbjct: 448 KLQTCLGLAML-LKSYTFSLEDCDVDRPLLI 477 >AY193729-1|AAO62002.1| 499|Anopheles gambiae cytochrome P450 CYPm3r9 protein. Length = 499 Score = 22.2 bits (45), Expect = 9.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 134 NFYATSTKEHITL*IKGHY 78 NF + TKEHIT+ K Y Sbjct: 45 NFGSIGTKEHITVPFKRIY 63 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 455,272 Number of Sequences: 2352 Number of extensions: 8379 Number of successful extensions: 20 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 42095889 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -