BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0677 (680 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 29 0.027 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 27 0.19 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 23 1.8 AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 22 5.3 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 22 5.3 S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subu... 21 7.1 DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 21 9.3 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 9.3 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 9.3 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 21 9.3 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 21 9.3 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 29.5 bits (63), Expect = 0.027 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +2 Query: 554 WANSRSTPRSEASSRISVCPSLSTWVRTPSRCWTTRCTSGS 676 WA STP ++ S + P WV S T R T+ S Sbjct: 412 WARPPSTPSADGSKPVQTTPKPGQWVPEKSTSTTQRTTTVS 452 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 26.6 bits (56), Expect = 0.19 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -1 Query: 587 PPSAV*SASLPTGMPIPHAPKSPRPRNVLRRLQQWRG-RPS 468 P +A S + PTG+P P SP N+ + Q + RP+ Sbjct: 211 PAAAPRSVATPTGIPTPSTSASPPTVNIKKESPQMQSYRPT 251 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 23.4 bits (48), Expect = 1.8 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -2 Query: 532 RPSRPDPETFSVGYNNGADVRLRPVLKNIVY 440 RP P PE SV N +D+R + ++ + Y Sbjct: 48 RPLAPAPERTSVLVTNNSDLRCKRKIQFMPY 78 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 269 MGLLDRNEHLFYRFVADNVAEMMPI 343 +GL+ R+ + YR +ADNVA I Sbjct: 150 VGLI-RDTAVLYRLLADNVANFNKI 173 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +2 Query: 287 NEHLFYRFVADNVAEMMPIVYTPTVGLACQKFG 385 N H F RF+A N+ ++ +Y+ V FG Sbjct: 108 NCHTFGRFLAPNLTYLLVALYSGYVWTDILGFG 140 >S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subunit protein. Length = 141 Score = 21.4 bits (43), Expect = 7.1 Identities = 6/12 (50%), Positives = 7/12 (58%) Frame = +2 Query: 542 WASLWANSRSTP 577 W S W N +TP Sbjct: 86 WVSFWLNRNATP 97 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 21.0 bits (42), Expect = 9.3 Identities = 5/13 (38%), Positives = 9/13 (69%) Frame = +2 Query: 539 GWASLWANSRSTP 577 GW ++W + + TP Sbjct: 314 GWTTVWDDEQKTP 326 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.0 bits (42), Expect = 9.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -1 Query: 557 PTGMPIPHAPKSPRP 513 PTG+ PH SP P Sbjct: 226 PTGLIPPHPGLSPHP 240 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.0 bits (42), Expect = 9.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -1 Query: 557 PTGMPIPHAPKSPRP 513 PTG+ PH SP P Sbjct: 118 PTGLIPPHPGLSPHP 132 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 21.0 bits (42), Expect = 9.3 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -3 Query: 525 VAQTQKRSPSVTTMARTSVSGQFLRTSYTCPLSWIV 418 + ++ + PSV ++R S S +T YT P +V Sbjct: 352 IKESLRLYPSVPFISRVSGSEIQTKTGYTIPKDCMV 387 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 21.0 bits (42), Expect = 9.3 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = -3 Query: 525 VAQTQKRSPSVTTMARTSVSGQFLRTSYTCPLSWIV 418 + ++ + PSV ++R S S +T YT P +V Sbjct: 352 IKESLRLYPSVPFISRVSGSEIQTKTGYTIPKDCMV 387 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,549 Number of Sequences: 336 Number of extensions: 4543 Number of successful extensions: 17 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17801955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -