BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0672 (671 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_03_0029 + 11724581-11724583,11726413-11726610,11726874-117270... 29 3.4 >09_03_0029 + 11724581-11724583,11726413-11726610,11726874-11727038, 11727217-11727283,11727645-11727812,11728070-11728194, 11728288-11728446,11728552-11728714,11728795-11728920, 11729000-11729083,11729161-11729528,11729613-11729813, 11729909-11730018,11730113-11730197,11730360-11730488, 11730580-11730667,11730805-11730893,11730968-11731267 Length = 875 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/52 (28%), Positives = 28/52 (53%) Frame = -1 Query: 578 FYLIHTSIIYSFKFI*HYEFAIELKFSYVYVNLRVNYATSNVRFFVNKVTVT 423 F++I S+I F +++I+ F ++Y+NL++ A FF + T T Sbjct: 341 FFVIFGSLI-GLNFFRLNDYSIQFAFFFIYINLQIALAFFVASFFSSVKTAT 391 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,469,901 Number of Sequences: 37544 Number of extensions: 197300 Number of successful extensions: 280 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 280 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1703141568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -