BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0672 (671 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g47740.1 68416.m05201 ABC transporter family protein ATP bind... 31 0.70 At1g27490.1 68414.m03351 hypothetical protein similar to MYB tra... 28 4.9 >At3g47740.1 68416.m05201 ABC transporter family protein ATP binding cassette transporter ABC1, Homo sapiens, PIR2:A54774 Length = 947 Score = 31.1 bits (67), Expect = 0.70 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = -1 Query: 593 LKLNYFYLIHTSI---IYSFKFI*HYEFAIELKFSYVYVNLRVNYA 465 L L+ FY+I I + KF +F+++ F +VY+NL+++ A Sbjct: 408 LALSTFYIIFLMIFGSVIGLKFFLLNDFSLQFSFYFVYINLQISIA 453 >At1g27490.1 68414.m03351 hypothetical protein similar to MYB transcription factor isolog (AC002335) Length = 164 Score = 28.3 bits (60), Expect = 4.9 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = -1 Query: 284 LHLMQRTLKYPISNIHI 234 LHL++ TLK+P+ N+H+ Sbjct: 41 LHLLRSTLKFPLLNLHL 57 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,178,776 Number of Sequences: 28952 Number of extensions: 189962 Number of successful extensions: 253 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 253 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1422784080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -