BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0669 (704 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0017 - 129261-129335,129352-129426,129565-129645,129929-13... 29 4.8 >11_01_0017 - 129261-129335,129352-129426,129565-129645,129929-130040, 130131-131177,131256-131347,131773-131943,132150-132253, 132367-132501,132583-132724,132803-133059,133126-133337, 133417-133454 Length = 846 Score = 28.7 bits (61), Expect = 4.8 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 5/53 (9%) Frame = -3 Query: 177 QISMLNSPFHCSN----FGWNTGIKKTPPTEPRYANTTLSSQEQITSTV-PDI 34 Q +ML HC++ F +TGIK + +NT+L S+ Q+TS+ PDI Sbjct: 574 QQNMLVQSVHCTDQMPQFDSSTGIKPSLAYSQLDSNTSLCSEVQLTSSEGPDI 626 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,820,901 Number of Sequences: 37544 Number of extensions: 386706 Number of successful extensions: 966 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 937 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 966 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -