BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0667 (681 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 27 0.14 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 27 0.19 AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax prot... 27 0.19 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 25 0.57 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 3.1 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 4.0 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 22 4.0 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 5.3 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 5.3 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 5.3 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 5.3 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 5.3 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 5.3 AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax pr... 22 5.3 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 5.3 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 7.1 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 21 7.1 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 27.1 bits (57), Expect = 0.14 Identities = 12/56 (21%), Positives = 21/56 (37%) Frame = -1 Query: 552 PVNVLRHVSDSGSQS*RLYPNWRSANGLWANQRNTLHWYAPGELSKELHNRPSKQS 385 P V V S + ++P+W + W + T W+ + RP+ S Sbjct: 1014 PPQVTTGVDTGASSTEHMHPDWTTKPSTWWSSTTTSPWWTTTTTRRTTTTRPTTTS 1069 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 26.6 bits (56), Expect = 0.19 Identities = 26/86 (30%), Positives = 34/86 (39%), Gaps = 4/86 (4%) Frame = -1 Query: 480 ANGLWANQRNTLHWYAPGELSKELHNRPSKQSLCHHRPHRQPYCLSCLTKSHRKV----H 313 ANGL R T Y EL KE H + L R + L CLT+ K+ Sbjct: 219 ANGLRRRGRQTYTRYQTLELEKEFH---TNHYLTRRRRIEMAHAL-CLTERQIKIWFQNR 274 Query: 312 RSTLISELRSRSRHQEQALKEQGSSA 235 R L E+++ EQ + Q A Sbjct: 275 RMKLKKEIQAIKELNEQEKQAQAQKA 300 >AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax protein. Length = 96 Score = 26.6 bits (56), Expect = 0.19 Identities = 26/86 (30%), Positives = 34/86 (39%), Gaps = 4/86 (4%) Frame = -1 Query: 480 ANGLWANQRNTLHWYAPGELSKELHNRPSKQSLCHHRPHRQPYCLSCLTKSHRKV----H 313 ANGL R T Y EL KE H + L R + L CLT+ K+ Sbjct: 1 ANGLRRRGRQTYTRYQTLELEKEFH---TNHYLTRRRRIEMAHAL-CLTERQIKIWFQNR 56 Query: 312 RSTLISELRSRSRHQEQALKEQGSSA 235 R L E+++ EQ + Q A Sbjct: 57 RMKLKKEIQAIKELNEQEKQAQAQKA 82 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 25.0 bits (52), Expect = 0.57 Identities = 10/42 (23%), Positives = 20/42 (47%) Frame = +3 Query: 96 EQCKIVKLYSQHANISDAWSSWI*RQVLSDSA*CTGSCHQPV 221 + C+ ++Y ++ W+ WI + D+ C G C P+ Sbjct: 269 DPCRRRQMYVDFGSVG--WNDWIVAPLGYDAYYCGGECEYPI 308 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.6 bits (46), Expect = 3.1 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +2 Query: 470 RPFAERQLGYNRQLWD 517 RPF ER +G +W+ Sbjct: 331 RPFPERSMGITPMIWN 346 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.2 bits (45), Expect = 4.0 Identities = 13/54 (24%), Positives = 23/54 (42%) Frame = -1 Query: 378 HHRPHRQPYCLSCLTKSHRKVHRSTLISELRSRSRHQEQALKEQGSSACQSVIL 217 H + H Y SC S+ + +L LR R H + ++ + C +I+ Sbjct: 277 HMKSHSNVYRYSCRDCSYATKYCHSLKIHLR-RYGHTPNVVLDEEGNPCPDIII 329 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 22.2 bits (45), Expect = 4.0 Identities = 13/47 (27%), Positives = 18/47 (38%), Gaps = 6/47 (12%) Frame = -1 Query: 498 YPNWRSANGLWANQR----NTLHWYA--PGELSKELHNRPSKQSLCH 376 +P WR +W N WY LS EL +P+ + H Sbjct: 653 FPRWRQTLAMWLNHNPNYAEVTDWYTGWKNMLSDELLAQPTIKENFH 699 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 Query: 483 SANGLWANQRNTLHWYAPGELSKELH 406 +ANG QR + Y EL KE H Sbjct: 215 NANGETKRQRTSYTRYQTLELEKEFH 240 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 Query: 483 SANGLWANQRNTLHWYAPGELSKELH 406 +ANG QR + Y EL KE H Sbjct: 215 NANGETKRQRTSYTRYQTLELEKEFH 240 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 Query: 483 SANGLWANQRNTLHWYAPGELSKELH 406 +ANG QR + Y EL KE H Sbjct: 215 NANGETKRQRTSYTRYQTLELEKEFH 240 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 Query: 483 SANGLWANQRNTLHWYAPGELSKELH 406 +ANG QR + Y EL KE H Sbjct: 215 NANGETKRQRTSYTRYQTLELEKEFH 240 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 Query: 483 SANGLWANQRNTLHWYAPGELSKELH 406 +ANG QR + Y EL KE H Sbjct: 171 NANGETKRQRTSYTRYQTLELEKEFH 196 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 Query: 483 SANGLWANQRNTLHWYAPGELSKELH 406 +ANG QR + Y EL KE H Sbjct: 215 NANGETKRQRTSYTRYQTLELEKEFH 240 >AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax protein. Length = 100 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 Query: 483 SANGLWANQRNTLHWYAPGELSKELH 406 +ANG QR + Y EL KE H Sbjct: 3 NANGETKRQRTSYTRYQTLELEKEFH 28 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 Query: 483 SANGLWANQRNTLHWYAPGELSKELH 406 +ANG QR + Y EL KE H Sbjct: 215 NANGETKRQRTSYTRYQTLELEKEFH 240 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 7.1 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +2 Query: 482 ERQLGYNRQLWDPESET 532 ER+ G+N L+ P S++ Sbjct: 286 ERETGHNAPLYSPSSDS 302 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 553 SFAAGVHGGVLSP 591 SF+ G HG +LSP Sbjct: 48 SFSMGGHGSLLSP 60 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,924 Number of Sequences: 336 Number of extensions: 3751 Number of successful extensions: 19 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17801955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -