BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0661 (487 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 24 2.4 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 24 2.4 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 24 3.2 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 24 3.2 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 22 9.7 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 24.2 bits (50), Expect = 2.4 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = +1 Query: 190 YEKRSTYGSVYCSS-GAWQGISSYLPELTNPIVACFSESESRVRYQAAEALFN 345 ++++ +Y S SS G G ++YLP NP+ S +R Q AL N Sbjct: 432 HDRKPSYSSSERSSTGILGGTAAYLPASINPVKL---RETSTIRRQRRTALGN 481 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 24.2 bits (50), Expect = 2.4 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = +1 Query: 190 YEKRSTYGSVYCSS-GAWQGISSYLPELTNPIVACFSESESRVRYQAAEALFN 345 ++++ +Y S SS G G ++YLP NP+ S +R Q AL N Sbjct: 433 HDRKPSYSSSERSSTGILGGTAAYLPASINPVKL---RETSTIRRQRRTALGN 482 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.8 bits (49), Expect = 3.2 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 240 PSPTATVDRPISAPF 196 P PT+T RP+ PF Sbjct: 522 PVPTSTTSRPLRTPF 536 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.8 bits (49), Expect = 3.2 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 240 PSPTATVDRPISAPF 196 P PT+T RP+ PF Sbjct: 521 PVPTSTTSRPLRTPF 535 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 22.2 bits (45), Expect = 9.7 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = -1 Query: 280 LDLLILVSNY*CLAKPHCYSRQTH 209 ++ L L N+ +PHC++ +T+ Sbjct: 653 IEFLFLNDNHIVHVEPHCFTHKTN 676 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 465,598 Number of Sequences: 2352 Number of extensions: 8476 Number of successful extensions: 26 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 42708759 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -