BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0661 (487 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 23 1.3 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 2.3 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 23.4 bits (48), Expect = 1.3 Identities = 9/36 (25%), Positives = 20/36 (55%) Frame = -2 Query: 486 GHDVLEQSIQQFSSMLHLLLRISSEFSQRIENYREL 379 G D+ + + + + L +++ EFS+R+ + EL Sbjct: 367 GEDISDYKFRHITEITILTVQLIVEFSKRLPGFDEL 402 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.6 bits (46), Expect = 2.3 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +2 Query: 47 DKLYEKRKVAGVEIEKMVKDFNDAKNTSQIKKLIKVL 157 ++L KR + EK+VKD AK+ + ++K+L Sbjct: 301 EELLGKRNICIAIKEKLVKDSGVAKDAAYDNIVLKLL 337 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,393 Number of Sequences: 438 Number of extensions: 2338 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13297932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -