BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0658 (755 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0658 + 5342508-5343602,5343697-5343764,5343994-5344042,534... 29 5.3 >11_01_0658 + 5342508-5343602,5343697-5343764,5343994-5344042, 5344217-5344333,5344438-5344506,5344631-5344725, 5345580-5345658,5346499-5346563,5347368-5347461, 5347675-5347744,5348363-5349357 Length = 931 Score = 28.7 bits (61), Expect = 5.3 Identities = 22/99 (22%), Positives = 43/99 (43%) Frame = +1 Query: 187 QTFMKKTKAKPRAKNQQTLLDIMPSLIKEIKQKLKVPVTRAKKMPLRNQQFKQMGKFQQL 366 Q ++ TK P+A L + I +++Q+ + K +PL+ Q +Q + QQ Sbjct: 264 QHLLQLTKQNPQAAAAAQLNLLQQQRILQMQQQQQQQQQILKNLPLQRNQLQQQQQQQQQ 323 Query: 367 RKKLKVQILVAPMMSHQNRHLSPTKQLKNLTLHQLRNKN 483 +++L Q + ++ P K LT + +N Sbjct: 324 QQQLLRQQSLNMRTPGKSAPYEPGTCAKRLTHYMYHQQN 362 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,635,434 Number of Sequences: 37544 Number of extensions: 237431 Number of successful extensions: 671 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 657 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 671 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2016060588 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -