BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0658 (755 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 27 0.14 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 21 9.4 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 27.5 bits (58), Expect = 0.14 Identities = 19/43 (44%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = -2 Query: 544 FNRLL--FRF*RNIXXXXXXXXXSCFLAGVMLSFLTAWLGLDA 422 F+RL+ FRF R I L VMLS+ + WLGLDA Sbjct: 186 FSRLVVFFRFERQIGHHLIQTFAPSTLV-VMLSWFSFWLGLDA 227 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 21.4 bits (43), Expect = 9.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +3 Query: 567 VHHKKKRNHQMTIVVMMNLRKRFHKNQLLHLPN 665 VH++K H+M V +R K L+ +P+ Sbjct: 322 VHYRKPSTHKMAPWVRKIFIRRLPKLLLMRVPD 354 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,285 Number of Sequences: 438 Number of extensions: 2493 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23753925 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -