BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0655 (702 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0798 + 7314885-7314953,7315324-7315387,7315489-7315677,731... 30 1.5 >12_01_0798 + 7314885-7314953,7315324-7315387,7315489-7315677, 7316430-7316625,7316727-7316953,7317177-7318134, 7320104-7321307,7321517-7321876,7321965-7323195, 7323334-7323599,7323738-7326335 Length = 2453 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = -3 Query: 229 DLNGVHVNAESAESKTRLTLSPTSIAYPLHLLCIH 125 DLN +H+ E+ E+ TR T + ++YP+ + +H Sbjct: 132 DLNTLHLIKENGEALTRRTSNQLKLSYPIVNIVVH 166 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,703,096 Number of Sequences: 37544 Number of extensions: 246449 Number of successful extensions: 450 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 450 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1803843684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -