BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0655 (702 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 4.9 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 4.9 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 6.5 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 8.6 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 22.2 bits (45), Expect = 4.9 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -2 Query: 626 SDIATRIRYAIRQP 585 SD+ T++RY + QP Sbjct: 466 SDVVTKLRYEVFQP 479 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 22.2 bits (45), Expect = 4.9 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -2 Query: 626 SDIATRIRYAIRQP 585 SD+ T++RY + QP Sbjct: 434 SDVVTKLRYEVFQP 447 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.8 bits (44), Expect = 6.5 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 93 YTTSERMYCSRDKYGNKPNGSFETQ 19 Y + +CS +K K N +FE Q Sbjct: 446 YNKNYTKFCSTEKRLTKQNTAFENQ 470 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 8.6 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -1 Query: 516 N*F*SNCTLILLFFVRNKTATTRSYRVRDI 427 N F NC++ L + N+T+T R+ D+ Sbjct: 680 NPFNCNCSMDWLPGINNQTSTREYPRIMDL 709 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,840 Number of Sequences: 438 Number of extensions: 3740 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -