BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0655 (702 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56670.1 68416.m06303 hypothetical protein hypothetical prote... 28 5.2 At3g09470.2 68416.m01126 expressed protein 28 5.2 At3g09470.1 68416.m01125 expressed protein 28 5.2 >At3g56670.1 68416.m06303 hypothetical protein hypothetical proteins - Arabidopsis thaliana Length = 233 Score = 28.3 bits (60), Expect = 5.2 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = -1 Query: 189 RKLASPCHPQVLLILYTYCVFTKINKLINLLGYTTSERMYCSRDKYGNKPN 37 R L + C ++L + YC++ +KL+ +L Y D G PN Sbjct: 159 RILGATCGGEILFAKWMYCIYHYEDKLLCVLYYEPKRNSMRGVDVEGTLPN 209 >At3g09470.2 68416.m01126 expressed protein Length = 437 Score = 28.3 bits (60), Expect = 5.2 Identities = 9/21 (42%), Positives = 18/21 (85%) Frame = -3 Query: 646 LIIWQNIAISLLAYVTPYVSL 584 L +WQ+ AI+++ +++PY+SL Sbjct: 384 LKVWQSAAIAIVFFLSPYISL 404 >At3g09470.1 68416.m01125 expressed protein Length = 464 Score = 28.3 bits (60), Expect = 5.2 Identities = 9/21 (42%), Positives = 18/21 (85%) Frame = -3 Query: 646 LIIWQNIAISLLAYVTPYVSL 584 L +WQ+ AI+++ +++PY+SL Sbjct: 384 LKVWQSAAIAIVFFLSPYISL 404 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,805,719 Number of Sequences: 28952 Number of extensions: 226928 Number of successful extensions: 361 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 361 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1506636208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -