BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0651 (741 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC044581-1|AAH44581.1| 523|Homo sapiens PKD2L2 protein protein. 30 7.6 AF182034-1|AAF65622.1| 624|Homo sapiens polycystic kidney disea... 30 7.6 AF118125-1|AAD46478.1| 609|Homo sapiens polycystin-2-like prote... 30 7.6 >BC044581-1|AAH44581.1| 523|Homo sapiens PKD2L2 protein protein. Length = 523 Score = 30.3 bits (65), Expect = 7.6 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -2 Query: 548 ILFYFIFLVYLCFATIEKINTYIILSYFIRQIM 450 +L YFIFL+ LC T +N ++ Y++ ++M Sbjct: 32 LLLYFIFLINLCILTFGMVNPHM---YYLNKVM 61 >AF182034-1|AAF65622.1| 624|Homo sapiens polycystic kidney disease-like 2 protein protein. Length = 624 Score = 30.3 bits (65), Expect = 7.6 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -2 Query: 548 ILFYFIFLVYLCFATIEKINTYIILSYFIRQIM 450 +L YFIFL+ LC T +N ++ Y++ ++M Sbjct: 32 LLLYFIFLINLCILTFGMVNPHM---YYLNKVM 61 >AF118125-1|AAD46478.1| 609|Homo sapiens polycystin-2-like protein protein. Length = 609 Score = 30.3 bits (65), Expect = 7.6 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -2 Query: 548 ILFYFIFLVYLCFATIEKINTYIILSYFIRQIM 450 +L YFIFL+ LC T +N ++ Y++ ++M Sbjct: 32 LLLYFIFLINLCILTFGMVNPHM---YYLNKVM 61 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,355,409 Number of Sequences: 237096 Number of extensions: 2022214 Number of successful extensions: 2801 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2721 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2773 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8847149012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -