BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0651 (741 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 24 1.7 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 23 2.3 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 5.3 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 7.0 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.2 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.2 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -1 Query: 144 NQFHIYEMSKTCVNGVLKNIRCCKVTVLMQNN 49 N + + SK ++ + KN++CC V L N Sbjct: 124 NGYFLNSESKDFIDFIQKNLQCCGVHSLSDYN 155 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 23.4 bits (48), Expect = 2.3 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 5/31 (16%) Frame = +3 Query: 417 IIFPTF-----IFYQLHYLSYKVR*NYVCIN 494 I+FP F +FY YLS R NY +N Sbjct: 429 IVFPLFFLAINVFYWFAYLSRSERINYYNVN 459 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -1 Query: 183 TKGRGPSSVLDYKNQFHIYEMSKTCVNGV 97 + G GP +DY+N +Y+ +NG+ Sbjct: 293 SNGLGPIKDIDYENVQSLYQPHLRGLNGL 321 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 7.0 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +1 Query: 289 SFLFEILCSHIVFS 330 S +FE LC+HI +S Sbjct: 147 SGMFEALCNHIKYS 160 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 9.2 Identities = 11/45 (24%), Positives = 21/45 (46%) Frame = -1 Query: 300 KQETRPKLKSVQCEIRCLYFYNWNSCIRAQTSKETQSIRTKGRGP 166 + T +LK + C + ++ I + S S+RT+G+ P Sbjct: 1455 RHATSHELKGLLCGNTYQLYLTSHNKIGSSPSSPVLSVRTQGQAP 1499 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 9.2 Identities = 11/45 (24%), Positives = 21/45 (46%) Frame = -1 Query: 300 KQETRPKLKSVQCEIRCLYFYNWNSCIRAQTSKETQSIRTKGRGP 166 + T +LK + C + ++ I + S S+RT+G+ P Sbjct: 1451 RHATSHELKGLLCGNTYQLYLTSHNKIGSSPSSPVLSVRTQGQAP 1495 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,700 Number of Sequences: 438 Number of extensions: 3986 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -