BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0647 (685 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI00006CC403 Cluster: hypothetical protein TTHERM_0013... 34 3.7 >UniRef50_UPI00006CC403 Cluster: hypothetical protein TTHERM_00133620; n=1; Tetrahymena thermophila SB210|Rep: hypothetical protein TTHERM_00133620 - Tetrahymena thermophila SB210 Length = 367 Score = 33.9 bits (74), Expect = 3.7 Identities = 16/50 (32%), Positives = 30/50 (60%) Frame = -1 Query: 403 ICLFL*INIVLNSENHSVTPLYENEEKYLISRLNTQII*NVPTTVNKLVL 254 +CL+ I+ + N++NH++ P+ E EK + + QI N+ NK++L Sbjct: 33 MCLYCRIDHIDNNKNHNIIPINEIAEKIQLLQKPQQIQNNIINQANKILL 82 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 538,116,203 Number of Sequences: 1657284 Number of extensions: 9444980 Number of successful extensions: 18765 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 18274 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18765 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 53305790091 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -