BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0647 (685 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z77657-7|CAH60768.1| 320|Caenorhabditis elegans Hypothetical pr... 28 7.1 Z69790-3|CAD56579.1| 1234|Caenorhabditis elegans Hypothetical pr... 28 7.1 Z69790-2|CAA93653.2| 1271|Caenorhabditis elegans Hypothetical pr... 28 7.1 AF339882-1|AAK14396.1| 1329|Caenorhabditis elegans attractin pro... 28 7.1 >Z77657-7|CAH60768.1| 320|Caenorhabditis elegans Hypothetical protein F08H9.12 protein. Length = 320 Score = 27.9 bits (59), Expect = 7.1 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 2 LFEYFEMSFFLVYFNIHVLLLRDKR 76 LF YF S F++YF + L++RD + Sbjct: 61 LFSYFLFSTFILYFIVLYLIVRDSQ 85 >Z69790-3|CAD56579.1| 1234|Caenorhabditis elegans Hypothetical protein F33C8.1b protein. Length = 1234 Score = 27.9 bits (59), Expect = 7.1 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -3 Query: 659 VLRRNIEIYRGLYRTVPEIEDRAARPFYFSK 567 +++ IE YR R + EIE A+RPF +K Sbjct: 1161 MIKVRIEAYRRNQRRIDEIEHMASRPFASTK 1191 >Z69790-2|CAA93653.2| 1271|Caenorhabditis elegans Hypothetical protein F33C8.1a protein. Length = 1271 Score = 27.9 bits (59), Expect = 7.1 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -3 Query: 659 VLRRNIEIYRGLYRTVPEIEDRAARPFYFSK 567 +++ IE YR R + EIE A+RPF +K Sbjct: 1198 MIKVRIEAYRRNQRRIDEIEHMASRPFASTK 1228 >AF339882-1|AAK14396.1| 1329|Caenorhabditis elegans attractin protein. Length = 1329 Score = 27.9 bits (59), Expect = 7.1 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -3 Query: 659 VLRRNIEIYRGLYRTVPEIEDRAARPFYFSK 567 +++ IE YR R + EIE A+RPF +K Sbjct: 1198 MIKVRIEAYRRNQRRIDEIEHMASRPFASTK 1228 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,258,703 Number of Sequences: 27780 Number of extensions: 253862 Number of successful extensions: 533 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 529 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 533 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1560745544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -