BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0646 (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g39280.1 68415.m04823 RabGAP/TBC domain-containing protein co... 39 0.002 At3g55020.1 68416.m06110 RabGAP/TBC domain-containing protein lo... 35 0.036 At2g01750.1 68415.m00104 expressed protein 33 0.11 At2g12520.1 68415.m01354 hypothetical protein low similarity to ... 32 0.33 At3g47460.1 68416.m05161 SMC2-like condensin, putative similar t... 31 0.77 At4g25160.1 68417.m03622 protein kinase family protein contains ... 30 1.0 At1g56410.1 68414.m06487 heat shock cognate 70 kDa protein, puta... 30 1.3 At1g49040.2 68414.m05499 stomatal cytokinesis defective / SCD1 p... 29 1.8 At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 p... 29 1.8 At5g01850.1 68418.m00104 protein kinase, putative similar to pro... 29 3.1 At5g43130.1 68418.m05265 transcription initiation factor IID (TF... 28 4.1 At5g16210.1 68418.m01894 HEAT repeat-containing protein contains... 28 4.1 At1g13220.2 68414.m01534 nuclear matrix constituent protein-rela... 28 4.1 At1g17070.1 68414.m02077 D111/G-patch domain-containing protein ... 28 5.4 At5g61550.1 68418.m07724 protein kinase family protein contains ... 27 7.2 At4g36520.1 68417.m05185 trichohyalin-related low similarity to ... 27 7.2 At4g00650.1 68417.m00089 FRIGIDA protein identical to Swiss-Prot... 27 7.2 At2g05940.1 68415.m00645 protein kinase, putative similar to aux... 27 7.2 At4g18130.1 68417.m02695 phytochrome E (PHYE) identical to SP|P4... 27 9.5 At1g02740.1 68414.m00227 MRG family protein member of Pfam PF057... 27 9.5 >At2g39280.1 68415.m04823 RabGAP/TBC domain-containing protein contains Pfam profile PF00566: TBC domain Length = 771 Score = 39.1 bits (87), Expect = 0.002 Identities = 20/77 (25%), Positives = 44/77 (57%) Frame = +3 Query: 315 RLQVEVEELRRQLTDKQELLAAAAEAIDVLEQQGSVSTDSMEVSMNNSASMKXAADPHDE 494 +L+ V ELRR ++DK+E +A + + +EQ+ V+ D+ ++ ++A+ + AA+ E Sbjct: 637 QLEQGVTELRRLVSDKREQESAMIQVLMRMEQEHKVTEDARRLAEQDAATQRYAAEVLQE 696 Query: 495 TTEQRTPSTIRVRNRSL 545 E+ + + R++ Sbjct: 697 KYEEAVAALAEMEERAV 713 >At3g55020.1 68416.m06110 RabGAP/TBC domain-containing protein low similarity to SP|Q9BXI6 EBP50-PDZ interactor of 64 kDa (EPI64 protein) {Homo sapiens}; contains Pfam profile PF00566: TBC domain Length = 777 Score = 35.1 bits (77), Expect = 0.036 Identities = 19/77 (24%), Positives = 41/77 (53%) Frame = +3 Query: 315 RLQVEVEELRRQLTDKQELLAAAAEAIDVLEQQGSVSTDSMEVSMNNSASMKXAADPHDE 494 +L+ E+ E++R L+DKQE A + + +EQ+ V+ D+ + ++ + + AA E Sbjct: 651 QLEQEMAEVQRLLSDKQEQEGAMLQVLMRVEQEQKVTEDARIFAEQDAEAQRYAAQVLQE 710 Query: 495 TTEQRTPSTIRVRNRSL 545 E+ + + R++ Sbjct: 711 KYEEAVAALAEMEKRAV 727 >At2g01750.1 68415.m00104 expressed protein Length = 629 Score = 33.5 bits (73), Expect = 0.11 Identities = 23/62 (37%), Positives = 35/62 (56%) Frame = +3 Query: 258 EKLGNGSPPAVQGLLEHNVRLQVEVEELRRQLTDKQELLAAAAEAIDVLEQQGSVSTDSM 437 EK + +V G+L H++ LQ EV LR+ DK + L EAI++L ++ T +M Sbjct: 508 EKAAGTNNDSVPGVL-HDL-LQKEVITLRKAANDKDQSLRDKDEAIEMLAKKVETLTKAM 565 Query: 438 EV 443 EV Sbjct: 566 EV 567 >At2g12520.1 68415.m01354 hypothetical protein low similarity to protective antigen [Streptococcus pyogenes] GI:8996050, paramyosin [Anisakis simplex] GI:8117843 Length = 356 Score = 31.9 bits (69), Expect = 0.33 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +3 Query: 303 EHNVRLQVEVEELRRQLTDKQELLAAAAEAIDVLEQQ-GSVSTD 431 EH V Q E+E L+ +L+ ++L AE I ++E + G + D Sbjct: 135 EHEVSFQAEIERLKMELSTSKDLEKGYAEKIGLMEMEIGGLQVD 178 >At3g47460.1 68416.m05161 SMC2-like condensin, putative similar to SMC2-like condensin (TITAN3) [Arabidopsis thaliana] GI:14279543; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1171 Score = 30.7 bits (66), Expect = 0.77 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = +3 Query: 315 RLQVEVEELRRQLTDKQELLAAAAEAIDVLEQ 410 +L+ EVEE+R Q+ +K+ L + A+ + LE+ Sbjct: 742 KLEEEVEEMRSQIKEKEGLYKSCADTVSTLEK 773 >At4g25160.1 68417.m03622 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 835 Score = 30.3 bits (65), Expect = 1.0 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +3 Query: 291 QGLLEHNVRLQVEVEELRRQLTDKQELLAAA-AEAIDVLEQQGSVSTDSME 440 Q ++ V L EVE+LR +L QE+ A A E D + G ++ +E Sbjct: 340 QSYTDNQVNLNFEVEKLRAELRHVQEMYAVAQTETFDASRKLGELNQRRLE 390 >At1g56410.1 68414.m06487 heat shock cognate 70 kDa protein, putative / HSC70, putative / HSP70, putative strong similarity to heat shock cognate 70 kd protein 1 SP:P22953 [Arabidopsis thaliana (Mouse-ear cress)] Length = 617 Score = 29.9 bits (64), Expect = 1.3 Identities = 18/101 (17%), Positives = 43/101 (42%) Frame = +3 Query: 207 RIAEGEFSLEIEDLFFEEKLGNGSPPAVQGLLEHNVRLQVEVEELRRQLTDKQELLAAAA 386 ++ EGE + I++ + + +G PPA +G+ + V ++ + ++ Sbjct: 447 QVYEGERARTIDNNILGQFVLSGIPPAPRGIPQFTVCFDIDSNGILN--VSAEDKATGKK 504 Query: 387 EAIDVLEQQGSVSTDSMEVSMNNSASMKXAADPHDETTEQR 509 I + +G +S D +E + + K + H + E + Sbjct: 505 NKITITNDKGRLSKDDIEKMVQEAEKYKSEDEEHKKKVEAK 545 >At1g49040.2 68414.m05499 stomatal cytokinesis defective / SCD1 protein (SCD1) contains Pfam PF02141: DENN (AEX-3) domain; contains Pfam PF00400: WD domain, G-beta repeat (8 copies); identical to stomatal cytokinesis defective [Arabidopsis thaliana] GI:19743728; supporting cDNA gi|19743727|gb|AY082605.1|; PMID 12874123 Length = 909 Score = 29.5 bits (63), Expect = 1.8 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +1 Query: 64 SSKHASSIPSP-FSTSPRKLQEMAMPSTEGHDVTNISGISMKQYEEQLNGLRKENFHLKL 240 +S+ IP P FST + ++ P+ D G S++Q + L+ E+ L+L Sbjct: 310 TSEEIPQIPEPEFSTLRNDILKLLHPNVVAIDQLKGFGNSVEQCPKSLSKPWGEDHDLQL 369 Query: 241 RIYFLK 258 R+ FLK Sbjct: 370 RVIFLK 375 >At1g49040.1 68414.m05498 stomatal cytokinesis defective / SCD1 protein (SCD1) contains Pfam PF02141: DENN (AEX-3) domain; contains Pfam PF00400: WD domain, G-beta repeat (8 copies); identical to stomatal cytokinesis defective [Arabidopsis thaliana] GI:19743728; supporting cDNA gi|19743727|gb|AY082605.1|; PMID 12874123 Length = 1187 Score = 29.5 bits (63), Expect = 1.8 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +1 Query: 64 SSKHASSIPSP-FSTSPRKLQEMAMPSTEGHDVTNISGISMKQYEEQLNGLRKENFHLKL 240 +S+ IP P FST + ++ P+ D G S++Q + L+ E+ L+L Sbjct: 310 TSEEIPQIPEPEFSTLRNDILKLLHPNVVAIDQLKGFGNSVEQCPKSLSKPWGEDHDLQL 369 Query: 241 RIYFLK 258 R+ FLK Sbjct: 370 RVIFLK 375 >At5g01850.1 68418.m00104 protein kinase, putative similar to protein kinase [Arabidopsis thaliana] gi|1054633|emb|CAA63387; contains protein kinase domain, Pfam:PF00069 Length = 333 Score = 28.7 bits (61), Expect = 3.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 Query: 59 RTVLNMLRVYHHRLVQVLGSCK 124 R V M RV HH LV+ +G+CK Sbjct: 65 REVNMMSRVQHHNLVKFIGACK 86 >At5g43130.1 68418.m05265 transcription initiation factor IID (TFIID) component TAF4 family protein weak similarity to SP|O00268 Transcription initiation factor TFIID 135 kDa subunit {Homo sapiens}; contains Pfam profile PF05236: Transcription initiation factor TFIID component TAF4 family Length = 712 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +1 Query: 79 SSIPSPFSTSPRKLQEMAMPSTEGHDVTNISGISMKQYEEQLNGLRKEN 225 SS P P M + +DVT +SG+++++ EEQL KE+ Sbjct: 403 SSPPPPSKKQKVAGNSMDQSIEQLNDVTAVSGVNLREEEEQLFSGAKED 451 >At5g16210.1 68418.m01894 HEAT repeat-containing protein contains Pfam profile PF02985: HEAT repeat Length = 1180 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = -2 Query: 423 RLNPAALERRWPQLRPRAAPACQLIAVVTLPLLL 322 R P+A+ R L+PR A A +L + LPLLL Sbjct: 806 RFLPSAIHPRIKGLKPRTAVANRLATLCILPLLL 839 >At1g13220.2 68414.m01534 nuclear matrix constituent protein-related similar to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 1128 Score = 28.3 bits (60), Expect = 4.1 Identities = 8/32 (25%), Positives = 24/32 (75%) Frame = +3 Query: 318 LQVEVEELRRQLTDKQELLAAAAEAIDVLEQQ 413 LQ E+E++R ++T K+E++ +++++ +++ Sbjct: 484 LQQEIEKIRAEMTKKEEMIEEECKSLEIKKEE 515 >At1g17070.1 68414.m02077 D111/G-patch domain-containing protein Similar to SP|Q9ERA6 Tuftelin-interacting protein 11 {Mus musculus}; contains Pfam profile PF01585: G-patch domain Length = 849 Score = 27.9 bits (59), Expect = 5.4 Identities = 23/82 (28%), Positives = 39/82 (47%) Frame = +3 Query: 237 IEDLFFEEKLGNGSPPAVQGLLEHNVRLQVEVEELRRQLTDKQELLAAAAEAIDVLEQQG 416 +E+L EEK P + L+HN+RL V++ E Q D+ L E+ L+Q+ Sbjct: 327 LENLDAEEKAKEADVPMPE--LQHNLRLIVDLVEHEIQKIDRD--LRNERESALSLQQEK 382 Query: 417 SVSTDSMEVSMNNSASMKXAAD 482 + + E + +M+ AD Sbjct: 383 EMLINEEEKQKRHLENMEYIAD 404 >At5g61550.1 68418.m07724 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain; protein kinase 1, PnPK1, Populus nigra, EMBL:AB041503 Length = 845 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 285 AVQGLLEHNVRLQVEVEELRRQLTDKQELLAAA 383 +V + ++ V L E+E+LR +L QE+ A A Sbjct: 348 SVHSITDNQVNLNFEIEKLRAELKHVQEMYAMA 380 >At4g36520.1 68417.m05185 trichohyalin-related low similarity to SP|Q07283 Trichohyalin {Homo sapiens} Length = 1400 Score = 27.5 bits (58), Expect = 7.2 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 300 LEHNVRLQVEVEELRRQLTDKQELLAAAAEAIDVLEQ 410 LE ++ +E EE RQ+ ++QE A +VLEQ Sbjct: 762 LEQRLKATLEQEEKERQIKERQEREENERRAKEVLEQ 798 >At4g00650.1 68417.m00089 FRIGIDA protein identical to Swiss-Prot:Q9FDW0 FRIGIDA protein [Arabidopsis thaliana] Length = 318 Score = 27.5 bits (58), Expect = 7.2 Identities = 18/65 (27%), Positives = 27/65 (41%), Gaps = 1/65 (1%) Frame = +3 Query: 231 LEIEDLFFEEKLGNGSPPAVQGLLEHNVRLQVEVEELRRQLTDKQELLAAAAEAID-VLE 407 +E E + +G P ++ V VE +RQ D Q+ + + AID LE Sbjct: 36 VETESTSMDITIGQSKQPQFLKSIDELAAFSVAVETFKRQFDDLQKHIESIENAIDSKLE 95 Query: 408 QQGSV 422 G V Sbjct: 96 SNGVV 100 >At2g05940.1 68415.m00645 protein kinase, putative similar to auxin-regulated dual specificity cytosolic kinase [Lycopersicon esculentum] gi|14484938|gb|AAK62821 Length = 462 Score = 27.5 bits (58), Expect = 7.2 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +1 Query: 67 SKHASSIPSPFSTSPRKLQEMAMPSTEGHDVTNISGIS 180 S H S PSP + SP + STE H T +G++ Sbjct: 413 SNHPRSSPSPTTKSPSPTAKSPRNSTENHRRTLRNGVN 450 >At4g18130.1 68417.m02695 phytochrome E (PHYE) identical to SP|P42498 Phytochrome E {Arabidopsis thaliana} Length = 1112 Score = 27.1 bits (57), Expect = 9.5 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = +3 Query: 201 VKRIAEGEFSLEIEDLFFEEKLGNGSPPAVQGLLEHNVRLQVEVEE 338 +K I EG+ LE E+ E L + L E N +L+VEV E Sbjct: 928 LKSIEEGKLQLETEEFRLENILDTIISQVMIILRERNSQLRVEVAE 973 >At1g02740.1 68414.m00227 MRG family protein member of Pfam PF05712: MRG; similar to Transcription factor-like protein MRG15 (MORF-related gene 15 protein) (MSL3-1 protein) (Protein HSPC008/HSPC061) (SP:Q9UBU8) {Homo sapiens} Length = 316 Score = 27.1 bits (57), Expect = 9.5 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = +3 Query: 252 FEEKLGNG-SPPAVQGLLEHNVRLQVEVEELRRQLTDKQELLAAAAE-AIDVLEQQGSV 422 +EE + G SP V G EH +RL V++ EL + +E L + +D+L + SV Sbjct: 242 YEESVSGGVSPSTVYG-AEHLLRLFVKLPELLVHVNMAEETLKELQDNFVDILRKNQSV 299 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,231,686 Number of Sequences: 28952 Number of extensions: 237561 Number of successful extensions: 903 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 882 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 903 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -