BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0645 (740 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0099 - 1202668-1203023,1203097-1206037 29 3.9 02_02_0550 - 11413912-11414079,11414338-11414513,11414617-114146... 29 3.9 >10_01_0099 - 1202668-1203023,1203097-1206037 Length = 1098 Score = 29.1 bits (62), Expect = 3.9 Identities = 17/56 (30%), Positives = 33/56 (58%), Gaps = 2/56 (3%) Frame = -1 Query: 614 NIYMSVGLPTTVAGALIMRTLVGVRNNNVNFKWPAS-GRVQLVIYNLSISTN-YTG 453 N + S LP T+ ++ ++ V NN ++ P GR+Q++++ L++S N +TG Sbjct: 623 NNHFSGNLPATIGNLASIQIMLDVSNNKLDGLLPQDFGRMQMLVF-LNLSHNQFTG 677 >02_02_0550 - 11413912-11414079,11414338-11414513,11414617-11414629, 11414844-11414871,11415447-11415784 Length = 240 Score = 29.1 bits (62), Expect = 3.9 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = +2 Query: 86 LKPIVRGRSQGYLKLWVSHQYRISNFNLSL 175 +K I++G S GY K+W H+YR N N+ + Sbjct: 121 IKVILQGLSMGYKKVW-WHKYRNLNKNIDI 149 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,012,637 Number of Sequences: 37544 Number of extensions: 290757 Number of successful extensions: 397 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 397 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1957111448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -