BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0642 (692 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-... 27 0.13 M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-... 22 4.8 >M29490-1|AAA27725.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E30. ). Length = 109 Score = 27.5 bits (58), Expect = 0.13 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = -1 Query: 617 VRRCSEGRRASPECHRIRLREDNEQTARLDVEYLE 513 V+R G+ SPE R R EQ ARL E+ E Sbjct: 7 VKRSHNGKNGSPEEKRPRTAFSAEQLARLKREFAE 41 Score = 27.5 bits (58), Expect = 0.13 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = -3 Query: 468 VRRCSEGRRASPECHRIRLREDNEQTARLDVEYLE 364 V+R G+ SPE R R EQ ARL E+ E Sbjct: 7 VKRSHNGKNGSPEEKRPRTAFSAEQLARLKREFAE 41 >M29489-1|AAA27724.1| 109|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone E60. ). Length = 109 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = -1 Query: 614 RRCSEGRRASPECHRIRLREDNEQTARLDVEYLE 513 R G +PE R R EQ ARL E+ E Sbjct: 8 RSDGRGNGGTPEEKRPRTAFSGEQLARLKREFAE 41 Score = 22.2 bits (45), Expect = 4.8 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = -3 Query: 465 RRCSEGRRASPECHRIRLREDNEQTARLDVEYLE 364 R G +PE R R EQ ARL E+ E Sbjct: 8 RSDGRGNGGTPEEKRPRTAFSGEQLARLKREFAE 41 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,693 Number of Sequences: 438 Number of extensions: 5065 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -