BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0641 (687 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1466 + 30350112-30350978 31 1.1 07_01_0581 + 4320515-4320782,4320954-4321117,4321352-4321366 29 2.6 10_06_0104 + 10786613-10788040 28 8.0 >06_03_1466 + 30350112-30350978 Length = 288 Score = 30.7 bits (66), Expect = 1.1 Identities = 21/67 (31%), Positives = 33/67 (49%) Frame = -1 Query: 498 KHLASQVEAAVAFAPWSHSARIHVRTRKLWHRTRPLCISPLLRHRRARLGPLATTHGDSE 319 + ++ + A +F P S +A HVR+ L R+ PL +S L H A L HGD+ Sbjct: 7 RSISFPLSPARSFKPRSAAAACHVRSISLPCRSHPL-LSHLQSHIAAVRSWLLQDHGDAS 65 Query: 318 TGMSLGS 298 S+ + Sbjct: 66 ASASVSA 72 >07_01_0581 + 4320515-4320782,4320954-4321117,4321352-4321366 Length = 148 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +2 Query: 407 CQSLRVRTCMRALCDQGANATAAST*LARCFQSIKRS 517 C +R+ C RAL G+ T+ +T ARC I R+ Sbjct: 44 CGDVRIVKCDRALSTTGSATTSPTTNSARCLAPIDRA 80 >10_06_0104 + 10786613-10788040 Length = 475 Score = 27.9 bits (59), Expect = 8.0 Identities = 17/63 (26%), Positives = 29/63 (46%) Frame = +3 Query: 237 FPFHHHAVRLTNFVKKLSYALSPATYRSRSRRELLLTDPAEPFDVVEVEKYIVGEFGAKA 416 +P +L+ + YAL P+T S R ++ + DP E V + + VG+F Sbjct: 338 WPARQAGTKLSAVIDGDLYALEPST--SSDRGKIKIYDPQEDAWKVAIGQVPVGDFAESE 395 Query: 417 CVF 425 C + Sbjct: 396 CPY 398 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,465,642 Number of Sequences: 37544 Number of extensions: 364007 Number of successful extensions: 887 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 887 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -