BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0641 (687 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z12017-8|CAA78050.3| 371|Caenorhabditis elegans Hypothetical pr... 28 5.4 U61950-4|AAC24287.2| 303|Caenorhabditis elegans Hypothetical pr... 28 7.2 >Z12017-8|CAA78050.3| 371|Caenorhabditis elegans Hypothetical protein R08D7.4 protein. Length = 371 Score = 28.3 bits (60), Expect = 5.4 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = +2 Query: 134 KCVMSGVYCHFCCSNVYWKELVSRHRSNYQY 226 +C+ Y C+NV+ E+V+ H Y++ Sbjct: 67 QCIKDSEYAENLCNNVFNNEIVTSHEIRYKF 97 >U61950-4|AAC24287.2| 303|Caenorhabditis elegans Hypothetical protein C45E5.1 protein. Length = 303 Score = 27.9 bits (59), Expect = 7.2 Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = -2 Query: 611 SFAYQADGIMWVSPRCLLGTRSANNILWLDPE-SALLTEN 495 +F + ADG++W + G N L DPE S +T N Sbjct: 17 TFVFDADGVLWTGDIPIPGAAEWINTLLDDPEKSVFITTN 56 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,921,444 Number of Sequences: 27780 Number of extensions: 305735 Number of successful extensions: 649 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 649 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1571291122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -