BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0640 (755 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 137 4e-34 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 26 1.4 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 137 bits (331), Expect = 4e-34 Identities = 65/75 (86%), Positives = 71/75 (94%) Frame = +2 Query: 2 NAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 181 +AVITVPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAA+AYGLDK GERNVLIFDL Sbjct: 1 DAVITVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNVLIFDL 60 Query: 182 GGGTFDVSILTIEDG 226 GGGTFDVSILTI++G Sbjct: 61 GGGTFDVSILTIDEG 75 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 25.8 bits (54), Expect = 1.4 Identities = 16/70 (22%), Positives = 32/70 (45%) Frame = -3 Query: 276 DLTSQVGAPAVDFTSKIPSSMVRMDTSKVPPPRSKISTFRSPVPFLSRP*AIAAAVGSLM 97 D + +G V F S+ P ++V D++ +K+S+ LSR + A++ L Sbjct: 823 DYSQVLGEDTVKFISEYPRTLVANDSTNDLLSHNKVSSLHGSCDSLSRNVSQASSTSDLS 882 Query: 96 IRRTFKPEMV 67 + P+ + Sbjct: 883 KTISVAPDPI 892 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 834,080 Number of Sequences: 2352 Number of extensions: 18154 Number of successful extensions: 32 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -