BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0637 (694 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50312-6|AAL65771.1| 106|Caenorhabditis elegans Hypothetical pr... 30 1.4 Z92812-9|CAM84813.1| 338|Caenorhabditis elegans Hypothetical pr... 28 7.3 X86403-1|CAA60157.1| 575|Caenorhabditis elegans nicotinic acety... 27 9.6 U23525-1|AAK71377.1| 575|Caenorhabditis elegans Acetylcholine r... 27 9.6 >U50312-6|AAL65771.1| 106|Caenorhabditis elegans Hypothetical protein B0222.10 protein. Length = 106 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/44 (36%), Positives = 29/44 (65%) Frame = +2 Query: 353 INLNKIYNNQTSFLTIILIIYLFVNLVAVVKITNIFYGPLRSSN 484 I++N ++NN F+T +L+I+L++ L+ V +GPLR S+ Sbjct: 52 IHIN-LFNN---FVTFLLVIFLYIFLIYYVTFFVFPFGPLRVSH 91 >Z92812-9|CAM84813.1| 338|Caenorhabditis elegans Hypothetical protein T03E6.9 protein. Length = 338 Score = 27.9 bits (59), Expect = 7.3 Identities = 14/59 (23%), Positives = 29/59 (49%), Gaps = 3/59 (5%) Frame = +2 Query: 305 INKLFTKILFFNDENKINLNKIYNNQTSFLTIIL---IIYLFVNLVAVVKITNIFYGPL 472 + +FT +L + I + N Q +F I++ ++Y+ +V V I+ +FY + Sbjct: 221 VTSVFTCLLMIYESRNIVSKETLNMQRNFTGILIYQALVYIIFIIVPVAVISTLFYADI 279 >X86403-1|CAA60157.1| 575|Caenorhabditis elegans nicotinic acetylcholine receptor protein. Length = 575 Score = 27.5 bits (58), Expect = 9.6 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = +2 Query: 344 ENKINLNKIYNNQTSFLTIILIIYLFVNLVAVVKITNIFYGPLRSSNK 487 ENK+ N + +T F T+ILII L+A + + FY P+ S K Sbjct: 252 ENKMVFNVVIRRKTLFYTVILIIPTV--LMAFLSVM-AFYLPVDSGEK 296 >U23525-1|AAK71377.1| 575|Caenorhabditis elegans Acetylcholine receptor protein 2 protein. Length = 575 Score = 27.5 bits (58), Expect = 9.6 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = +2 Query: 344 ENKINLNKIYNNQTSFLTIILIIYLFVNLVAVVKITNIFYGPLRSSNK 487 ENK+ N + +T F T+ILII L+A + + FY P+ S K Sbjct: 252 ENKMVFNVVIRRKTLFYTVILIIPTV--LMAFLSVM-AFYLPVDSGEK 296 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,644,851 Number of Sequences: 27780 Number of extensions: 72241 Number of successful extensions: 190 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 190 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 190 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1592382278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -