BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0637 (694 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07727.1 68415.m00977 cytochrome b (MTCYB) (COB) (CYTB) conta... 33 0.18 >At2g07727.1 68415.m00977 cytochrome b (MTCYB) (COB) (CYTB) contains Pfam profile PF00033: Cytochrome b(N-terminal)/b6/petB; ontains Pfam profile PF00032: Cytochrome b(C-terminal)/b6/petD; 99% identical to apocytochrome B (GI:6851014), cytochrome b (GI:402962), and Cytochrome b (Swiss-Prot:P42792) [Arabidopsis thaliana] Length = 393 Score = 33.1 bits (72), Expect = 0.18 Identities = 15/43 (34%), Positives = 21/43 (48%) Frame = +3 Query: 564 PIFKIINNSLIDLXXXXXXXXXXXXXXLLALCLIIQIITGLFL 692 PI +N L+D L +CL+IQI+TG+FL Sbjct: 14 PISSTLNQHLVDYPTPSNLSYWWGFGPLAGICLVIQIVTGVFL 56 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,933,857 Number of Sequences: 28952 Number of extensions: 59590 Number of successful extensions: 110 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1477286152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -