BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0636 (685 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1673 - 28532923-28533009,28533058-28533117,28533664-285337... 28 7.9 >07_03_1673 - 28532923-28533009,28533058-28533117,28533664-28533732, 28534757-28534862,28535058-28535203,28535805-28536017, 28536523-28536546,28536647-28536704,28536739-28537022, 28538890-28539063,28539427-28539825 Length = 539 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -3 Query: 152 FSIIYLL-QMCNCACSF*LQNIFNTNY*PRI*SAISISLKFQRLF 21 FS++Y+L Q+ CAC+F + + Y PR I K ++ F Sbjct: 351 FSLLYVLFQVVTCACAFGIWFLDGGTYMPRHLHKEDICFKMEKAF 395 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,662,511 Number of Sequences: 37544 Number of extensions: 221508 Number of successful extensions: 359 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 355 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 359 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1733104716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -