BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0635 (743 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g15530.2 68415.m01778 zinc finger (C3HC4-type RING finger) fa... 29 3.3 At2g15530.1 68415.m01777 zinc finger (C3HC4-type RING finger) fa... 29 3.3 At5g60940.2 68418.m07645 transducin family protein / WD-40 repea... 28 7.5 At5g60940.1 68418.m07644 transducin family protein / WD-40 repea... 28 7.5 >At2g15530.2 68415.m01778 zinc finger (C3HC4-type RING finger) family protein similar to Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 704 Score = 29.1 bits (62), Expect = 3.3 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 2/66 (3%) Frame = -2 Query: 295 SNAGEHHTNVLHVKTSLVR--HPFEWKLVEFSVQAATTPSLISWAEQHVLGMGRP*SAQS 122 SN GE+ TN++H+ +L R H + W FS +A+ + AE+ P S Q Sbjct: 348 SNTGENQTNIVHL-PALTRNIHQYAWD-ASFSSRASNPSGIGMPAERLGPQWETPRSNQE 405 Query: 121 AGLFIP 104 LF P Sbjct: 406 QPLFAP 411 >At2g15530.1 68415.m01777 zinc finger (C3HC4-type RING finger) family protein similar to Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 704 Score = 29.1 bits (62), Expect = 3.3 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 2/66 (3%) Frame = -2 Query: 295 SNAGEHHTNVLHVKTSLVR--HPFEWKLVEFSVQAATTPSLISWAEQHVLGMGRP*SAQS 122 SN GE+ TN++H+ +L R H + W FS +A+ + AE+ P S Q Sbjct: 348 SNTGENQTNIVHL-PALTRNIHQYAWD-ASFSSRASNPSGIGMPAERLGPQWETPRSNQE 405 Query: 121 AGLFIP 104 LF P Sbjct: 406 QPLFAP 411 >At5g60940.2 68418.m07645 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to cleavage stimulation factor 50K chain Homo sapiens, PIR:A45142 Length = 337 Score = 27.9 bits (59), Expect = 7.5 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +3 Query: 183 DGVVAACTENSTNFHSKGCLTKLVFT-*RTLVWCSPALESVSLW 311 DGV A C + N H K +T VFT + V S +V LW Sbjct: 202 DGVSAKCVRSIGNAHGKSEVTSAVFTKDQRFVLSSGKDSTVKLW 245 >At5g60940.1 68418.m07644 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to cleavage stimulation factor 50K chain Homo sapiens, PIR:A45142 Length = 429 Score = 27.9 bits (59), Expect = 7.5 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +3 Query: 183 DGVVAACTENSTNFHSKGCLTKLVFT-*RTLVWCSPALESVSLW 311 DGV A C + N H K +T VFT + V S +V LW Sbjct: 294 DGVSAKCVRSIGNAHGKSEVTSAVFTKDQRFVLSSGKDSTVKLW 337 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,822,857 Number of Sequences: 28952 Number of extensions: 261648 Number of successful extensions: 722 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 722 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1643603136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -