BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0628 (675 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) 167 5e-42 SB_55955| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_55460| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_53830| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_51993| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_48637| Best HMM Match : No HMM Matches (HMM E-Value=.) 165 3e-41 SB_44589| Best HMM Match : No HMM Matches (HMM E-Value=.) 165 3e-41 SB_41057| Best HMM Match : No HMM Matches (HMM E-Value=.) 165 3e-41 SB_35355| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_30057| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_21880| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_20370| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_18391| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_17374| Best HMM Match : No HMM Matches (HMM E-Value=.) 165 3e-41 SB_13453| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_8948| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_4426| Best HMM Match : No HMM Matches (HMM E-Value=.) 165 3e-41 SB_3841| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_59571| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_58125| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_57761| Best HMM Match : No HMM Matches (HMM E-Value=.) 165 3e-41 SB_56157| Best HMM Match : No HMM Matches (HMM E-Value=.) 165 3e-41 SB_55483| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_54709| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_53175| Best HMM Match : No HMM Matches (HMM E-Value=.) 165 3e-41 SB_51431| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_49908| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_48866| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_48698| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_47677| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_43396| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_38339| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_33151| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_32791| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_25703| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_19242| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_18626| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_7960| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_4579| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 165 3e-41 SB_7640| Best HMM Match : Histone (HMM E-Value=4.80001e-41) 164 5e-41 SB_17756| Best HMM Match : Histone (HMM E-Value=8.5e-41) 163 9e-41 SB_13396| Best HMM Match : No HMM Matches (HMM E-Value=.) 163 1e-40 SB_45363| Best HMM Match : No HMM Matches (HMM E-Value=.) 162 2e-40 SB_55375| Best HMM Match : Histone (HMM E-Value=9.2e-35) 151 5e-37 SB_14746| Best HMM Match : Histone (HMM E-Value=4.4e-32) 146 1e-35 SB_5701| Best HMM Match : Linker_histone (HMM E-Value=5.9e-39) 140 9e-34 SB_5300| Best HMM Match : No HMM Matches (HMM E-Value=.) 139 2e-33 SB_512| Best HMM Match : No HMM Matches (HMM E-Value=.) 130 1e-30 SB_10761| Best HMM Match : No HMM Matches (HMM E-Value=.) 126 1e-29 SB_19243| Best HMM Match : Histone (HMM E-Value=1e-16) 126 2e-29 SB_23531| Best HMM Match : Histone (HMM E-Value=8.9e-09) 112 2e-25 SB_21745| Best HMM Match : Histone (HMM E-Value=1.1e-08) 92 3e-19 SB_11407| Best HMM Match : Histone (HMM E-Value=1.1e-08) 92 3e-19 SB_27350| Best HMM Match : Histone (HMM E-Value=1.1e-08) 92 3e-19 SB_37074| Best HMM Match : No HMM Matches (HMM E-Value=.) 86 2e-17 SB_15200| Best HMM Match : Histone (HMM E-Value=0.22) 86 2e-17 SB_17103| Best HMM Match : Histone (HMM E-Value=0.65) 84 1e-16 SB_47751| Best HMM Match : Histone (HMM E-Value=4.3e-07) 82 5e-16 SB_39847| Best HMM Match : Histone (HMM E-Value=1.3e-07) 77 1e-14 SB_35876| Best HMM Match : Histone (HMM E-Value=5.1) 63 2e-10 SB_49221| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_31724| Best HMM Match : Histone (HMM E-Value=4.8e-18) 40 0.002 SB_20764| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 38 0.007 SB_40217| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_3597| Best HMM Match : TAFH (HMM E-Value=3.8) 29 4.5 SB_40533| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 493 Score = 167 bits (407), Expect = 5e-42 Identities = 83/88 (94%), Positives = 85/88 (96%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGERLKLV 266 AIHAKRVTIMPKDIQLARRIRGER K V Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGERAKKV 139 >SB_55955| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_55460| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_53830| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_51993| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_48637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_44589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_41057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 2 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 61 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 62 AIHAKRVTIMPKDIQLARRIRGER 85 >SB_35355| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 94 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 10 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 69 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 70 AIHAKRVTIMPKDIQLARRIRGER 93 >SB_30057| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 260 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 176 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 235 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 236 AIHAKRVTIMPKDIQLARRIRGER 259 >SB_21880| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_20370| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_18391| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_17374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_13453| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_8948| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_4426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_3841| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_59571| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_58125| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_57761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_56157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_55483| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_54709| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_53175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_51431| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_49908| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_48866| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 205 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 121 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 180 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 181 AIHAKRVTIMPKDIQLARRIRGER 204 >SB_48698| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_47677| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_43396| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 131 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 47 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 106 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 107 AIHAKRVTIMPKDIQLARRIRGER 130 >SB_38339| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_33151| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_32791| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 94 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 10 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 69 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 70 AIHAKRVTIMPKDIQLARRIRGER 93 >SB_25703| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_19242| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_18626| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_7960| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_4579| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 165 bits (401), Expect = 3e-41 Identities = 81/84 (96%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_7640| Best HMM Match : Histone (HMM E-Value=4.80001e-41) Length = 136 Score = 164 bits (399), Expect = 5e-41 Identities = 81/84 (96%), Positives = 82/84 (97%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSLAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_17756| Best HMM Match : Histone (HMM E-Value=8.5e-41) Length = 136 Score = 163 bits (397), Expect = 9e-41 Identities = 80/84 (95%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ AL+EASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALKEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_13396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 163 bits (396), Expect = 1e-40 Identities = 79/84 (94%), Positives = 83/84 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRL+REIAQDFKTDLRFQS+A+ ALQEA+EAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLIREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_45363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 162 bits (394), Expect = 2e-40 Identities = 80/84 (95%), Positives = 82/84 (97%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQ LVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQLLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLARRIRGER 254 AIHAKRVTIMPKDIQLARRIRGER Sbjct: 112 AIHAKRVTIMPKDIQLARRIRGER 135 >SB_55375| Best HMM Match : Histone (HMM E-Value=9.2e-35) Length = 136 Score = 151 bits (366), Expect = 5e-37 Identities = 74/77 (96%), Positives = 76/77 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQLA 233 AIHAKRVTIMPKDIQLA Sbjct: 112 AIHAKRVTIMPKDIQLA 128 >SB_14746| Best HMM Match : Histone (HMM E-Value=4.4e-32) Length = 162 Score = 146 bits (354), Expect = 1e-35 Identities = 71/75 (94%), Positives = 74/75 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPKDIQ 227 AIHAKRVTIMPKDI+ Sbjct: 112 AIHAKRVTIMPKDIR 126 >SB_5701| Best HMM Match : Linker_histone (HMM E-Value=5.9e-39) Length = 370 Score = 140 bits (339), Expect = 9e-34 Identities = 68/72 (94%), Positives = 71/72 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKRVTIMPK 218 AIHAKRVTIMP+ Sbjct: 112 AIHAKRVTIMPQ 123 >SB_5300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 139 bits (337), Expect = 2e-33 Identities = 68/72 (94%), Positives = 70/72 (97%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEA+EAYLVGLFEDTNLC Sbjct: 49 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEAAEAYLVGLFEDTNLC 108 Query: 183 AIHAKRVTIMPK 218 AIHAKRVT+ K Sbjct: 109 AIHAKRVTLCQK 120 >SB_512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 130 bits (313), Expect = 1e-30 Identities = 63/66 (95%), Positives = 65/66 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLC 111 Query: 183 AIHAKR 200 AIHAKR Sbjct: 112 AIHAKR 117 >SB_10761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 126 bits (305), Expect = 1e-29 Identities = 59/82 (71%), Positives = 73/82 (89%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IR+ QKSTELLI+K+PFQRLVREI+Q+++ DLRF A+ ALQEA+EA++VG+F+D NLC Sbjct: 90 IRKLQKSTELLIKKVPFQRLVREISQNYRLDLRFHPDALLALQEATEAFIVGVFDDVNLC 149 Query: 183 AIHAKRVTIMPKDIQLARRIRG 248 AIHAKRVTIMPKD+ LA RIRG Sbjct: 150 AIHAKRVTIMPKDLHLALRIRG 171 >SB_19243| Best HMM Match : Histone (HMM E-Value=1e-16) Length = 117 Score = 126 bits (303), Expect = 2e-29 Identities = 61/66 (92%), Positives = 63/66 (95%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLC 182 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVG EDTNLC Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGFIEDTNLC 111 Query: 183 AIHAKR 200 AIHAKR Sbjct: 112 AIHAKR 117 >SB_23531| Best HMM Match : Histone (HMM E-Value=8.9e-09) Length = 110 Score = 112 bits (270), Expect = 2e-25 Identities = 55/58 (94%), Positives = 57/58 (98%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTN 176 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEASEAYLVGLFEDTN Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTN 109 >SB_21745| Best HMM Match : Histone (HMM E-Value=1.1e-08) Length = 46 Score = 92.3 bits (219), Expect = 3e-19 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +3 Query: 123 ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 254 ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER Sbjct: 2 ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 45 >SB_11407| Best HMM Match : Histone (HMM E-Value=1.1e-08) Length = 46 Score = 92.3 bits (219), Expect = 3e-19 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +3 Query: 123 ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 254 ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER Sbjct: 2 ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 45 >SB_27350| Best HMM Match : Histone (HMM E-Value=1.1e-08) Length = 46 Score = 92.3 bits (219), Expect = 3e-19 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +3 Query: 123 ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 254 ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER Sbjct: 2 ALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 45 >SB_37074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 86.2 bits (204), Expect = 2e-17 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEA 137 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEA 96 >SB_15200| Best HMM Match : Histone (HMM E-Value=0.22) Length = 97 Score = 86.2 bits (204), Expect = 2e-17 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEA 137 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+ ALQEA Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEA 96 >SB_17103| Best HMM Match : Histone (HMM E-Value=0.65) Length = 97 Score = 83.8 bits (198), Expect = 1e-16 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEA 137 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A ALQEA Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSARMALQEA 96 >SB_47751| Best HMM Match : Histone (HMM E-Value=4.3e-07) Length = 55 Score = 81.8 bits (193), Expect = 5e-16 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 141 EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 254 EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER Sbjct: 17 EAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 54 >SB_39847| Best HMM Match : Histone (HMM E-Value=1.3e-07) Length = 407 Score = 77.4 bits (182), Expect = 1e-14 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +3 Query: 129 QEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 254 Q+ ++ LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER Sbjct: 365 QQKAKKKLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 406 >SB_35876| Best HMM Match : Histone (HMM E-Value=5.1) Length = 157 Score = 63.3 bits (147), Expect = 2e-10 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPFQRLVREIAQDFKT 92 IRRYQKSTELLIRKLPFQRLVREIAQDFKT Sbjct: 52 IRRYQKSTELLIRKLPFQRLVREIAQDFKT 81 >SB_49221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 214 GMMVTRLA*IAHKLVSSNKPT 152 GMMVTRLA +AHKLVSSN+PT Sbjct: 10 GMMVTRLAWMAHKLVSSNRPT 30 >SB_31724| Best HMM Match : Histone (HMM E-Value=4.8e-18) Length = 150 Score = 39.5 bits (88), Expect = 0.002 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -3 Query: 214 GMMVTRLA*IAHKLVSSNKPT 152 GMMVTRLA +AHKLVSSN+PT Sbjct: 10 GMMVTRLAWMAHKLVSSNRPT 30 >SB_20764| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 68 Score = 37.9 bits (84), Expect = 0.007 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 3 IRRYQKSTELLIRKLPF 53 IRRYQKSTELLIRKLPF Sbjct: 52 IRRYQKSTELLIRKLPF 68 >SB_40217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 32.3 bits (70), Expect = 0.37 Identities = 12/41 (29%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +2 Query: 119 RSSPG-GKRGLSRWLVRRHQLVCYSRQTCDHHAEGYSTCST 238 R +P GK +++W++ RH + + T H+ Y+T +T Sbjct: 97 RKAPSSGKESMAKWILIRHDTIRHKHDTAQHNTTRYNTNTT 137 >SB_3597| Best HMM Match : TAFH (HMM E-Value=3.8) Length = 283 Score = 28.7 bits (61), Expect = 4.5 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +1 Query: 76 LRISKLICVSSLPPSELSRRQARLISLACSKTPTCVLFTPNV*PSCRRIFNLL 234 LR++ + + +L PS + + +R IS + PT PN+ RR +NLL Sbjct: 162 LRVADISRIDALLPSNNNHKNSRRISFVTTYNPT----LPNINDIIRRNYNLL 210 >SB_40533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 319 Score = 28.3 bits (60), Expect = 6.0 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +1 Query: 76 LRISKLICVSSLPPSELSRRQARLISLACSKTPTCVLFTPNV*PSCRRIFNLL 234 LR++ + + +L P+ + + +R IS + PT PN+ RR +NLL Sbjct: 198 LRVANISRIDALRPNNNNHKNSRRISFVTTYNPT----LPNINDIIRRNYNLL 246 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 27.9 bits (59), Expect = 7.9 Identities = 21/74 (28%), Positives = 34/74 (45%) Frame = +3 Query: 6 RRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCA 185 R+ ++S E + RK+ RE+ K+DL +S A+ + ASEA L E L Sbjct: 760 RQLKESEESIERKVEIIESGRELLAKLKSDLEQKSQALLKEEAASEALKKDLQEKEILLG 819 Query: 186 IHAKRVTIMPKDIQ 227 + + K I+ Sbjct: 820 ERYSDIETLNKQIE 833 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,591,471 Number of Sequences: 59808 Number of extensions: 343646 Number of successful extensions: 777 Number of sequences better than 10.0: 67 Number of HSP's better than 10.0 without gapping: 737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 776 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -