BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0624 (560 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 1.8 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 21 5.5 AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII pr... 21 7.2 AF017414-1|AAB70260.1| 209|Tribolium castaneum abdominal-AII pr... 21 7.2 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 21 9.6 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 23.0 bits (47), Expect = 1.8 Identities = 9/35 (25%), Positives = 16/35 (45%) Frame = +3 Query: 84 HDSFP*RTEGGRPHCGRRRPSHLSGNGWRSITGCG 188 ++S+P T G H G + ++ N W + G Sbjct: 162 YESWPFNTMSGATHHGGIKSDSVTSNAWWDVHSTG 196 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 21.4 bits (43), Expect = 5.5 Identities = 7/14 (50%), Positives = 9/14 (64%) Frame = -1 Query: 167 PTITGQMGWSSPAT 126 P I G M W+ P+T Sbjct: 433 PPIGGMMNWNMPST 446 >AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII protein. Length = 343 Score = 21.0 bits (42), Expect = 7.2 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 212 RSNIPEAKSTASDASPTITGQMGWSSPATVRPAA 111 +S EA + S +SP+ + SS A+ PAA Sbjct: 25 QSATTEAPAAYSSSSPSGSSPQHSSSSASTSPAA 58 >AF017414-1|AAB70260.1| 209|Tribolium castaneum abdominal-AII protein. Length = 209 Score = 21.0 bits (42), Expect = 7.2 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 212 RSNIPEAKSTASDASPTITGQMGWSSPATVRPAA 111 +S EA + S +SP+ + SS A+ PAA Sbjct: 25 QSATTEAPAAYSSSSPSGSSPQHSSSSASTSPAA 58 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 20.6 bits (41), Expect = 9.6 Identities = 7/15 (46%), Positives = 12/15 (80%) Frame = +2 Query: 395 NVFRAIKKKRCACNL 439 N++R IKK+ +C+L Sbjct: 160 NMYRTIKKRLRSCDL 174 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,249 Number of Sequences: 336 Number of extensions: 2418 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13786212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -