BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0624 (560 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 25 0.69 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 1.6 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 21 6.4 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 21 6.4 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 24.6 bits (51), Expect = 0.69 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 243 RGAEARRECGCN*ARRTRPVTSPERCKPSQR 335 R A R C C R R RCKPSQR Sbjct: 398 RRAFVRILCACCPGRVRRRYQPAFRCKPSQR 428 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 23.4 bits (48), Expect = 1.6 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +1 Query: 142 HPICPVMVGEASLAVDLASGMLERGVYVVAFSYPV 246 H I + A+ + ++ER VY V S+P+ Sbjct: 71 HTIIEMDSNPIKTALSVCKSLIERQVYAVVVSHPL 105 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.4 bits (43), Expect = 6.4 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = -2 Query: 352 AYVFSDLCEGLHRSGDV 302 +YV D EG+ +SGDV Sbjct: 188 SYVKDDGTEGIAKSGDV 204 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.4 bits (43), Expect = 6.4 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -1 Query: 497 EETDTVLHIEIEVSLHSRA 441 ++ T LH++I V +HS A Sbjct: 507 KDRSTGLHLQIRVGVHSGA 525 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,638 Number of Sequences: 438 Number of extensions: 3043 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16195212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -