BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0623 (765 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 28 0.27 Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precurso... 27 0.63 Z22930-7|CAA80512.1| 274|Anopheles gambiae trypsin protein. 26 1.1 Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. 26 1.1 L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7... 26 1.1 AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding pr... 25 1.9 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 25 2.6 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 25 2.6 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 25 3.4 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 24 4.5 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 24 5.9 CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 23 7.8 AY062190-1|AAL58551.1| 151|Anopheles gambiae cytochrome P450 CY... 23 7.8 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 28.3 bits (60), Expect = 0.27 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 382 DQQSPNIAAGVHENRNDEEVGAGDQG 459 DQ+ N G NRN GAGD G Sbjct: 256 DQRGGNYPRGTERNRNGNGYGAGDDG 281 >Z22930-4|CAA80516.1| 267|Anopheles gambiae Trypsinogen precursor of ANTRYP7 protein. Length = 267 Score = 27.1 bits (57), Expect = 0.63 Identities = 17/61 (27%), Positives = 28/61 (45%) Frame = +1 Query: 298 VRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNIAAGVHENRNDEEVGAGDQGLMFGYA 477 V V+H YDDS+ +DY + L + ++ V DE V AG ++ G+ Sbjct: 110 VARIVEHPNYDDSTIDYDY--ALLELESELTFSDVVQPVALPEQDEAVDAGTMTIVSGWG 167 Query: 478 T 480 + Sbjct: 168 S 168 >Z22930-7|CAA80512.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 26.2 bits (55), Expect = 1.1 Identities = 22/94 (23%), Positives = 37/94 (39%), Gaps = 1/94 (1%) Frame = +1 Query: 298 VRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNIAAGVHENRNDEEVGAGDQGLMFGYA 477 V V+H YD SS FDY + L G+ + DE V G + G+ Sbjct: 116 VARVVQHPKYDSSSIDFDYSLLELEDELTFSDAVQPVGL--PKQDETVKDGTMTTVSGWG 173 Query: 478 -TDETEECMPLM*CLHTNSIRKLQSSGEMENFGG 576 T E ++ + ++ + + + +FGG Sbjct: 174 NTQSAAESNAVLRAANVPTVNQKECNKAYSDFGG 207 >Z18889-1|CAA79327.1| 274|Anopheles gambiae trypsin protein. Length = 274 Score = 26.2 bits (55), Expect = 1.1 Identities = 22/94 (23%), Positives = 37/94 (39%), Gaps = 1/94 (1%) Frame = +1 Query: 298 VRETVKHIGYDDSSKGFDYKTCSVMLALDQQSPNIAAGVHENRNDEEVGAGDQGLMFGYA 477 V V+H YD SS FDY + L G+ + DE V G + G+ Sbjct: 116 VARVVQHPKYDSSSIDFDYSLLELEDELTFSDSVQPVGL--PKQDETVKDGTMTTVSGWG 173 Query: 478 -TDETEECMPLM*CLHTNSIRKLQSSGEMENFGG 576 T E ++ + ++ + + + +FGG Sbjct: 174 NTQSAAESNAVLRAANVPTVNQKECNKAYSDFGG 207 >L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7 protein. Length = 192 Score = 26.2 bits (55), Expect = 1.1 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 Query: 128 GEGHPDKMCDQISDAILDAHLNQD 199 G G PD QI AIL+ +N D Sbjct: 11 GNGEPDAFETQIGQAILELEMNSD 34 >AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding protein AgamOBP40 protein. Length = 282 Score = 25.4 bits (53), Expect = 1.9 Identities = 13/46 (28%), Positives = 19/46 (41%) Frame = -3 Query: 457 PGLLPQLPRHFCSHAPQQQCLVIVGLVRASHCMSCNQSLWTNHHNQ 320 P L L + + P+ QCL+ VR + +L N H Q Sbjct: 147 PSFLTSLTKGIITDCPEVQCLIRCAAVRTGLYTDKDGALLANLHRQ 192 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 25.0 bits (52), Expect = 2.6 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -3 Query: 391 IVGLVRASHCMSCNQSLWTNHHNQYV*PFRAQLFDNPR 278 +VG+V + MSC Q W H ++ P + L DN R Sbjct: 872 VVGVVCRTPVMSCPQDYWLCHASEECIPVQF-LCDNVR 908 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 25.0 bits (52), Expect = 2.6 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -3 Query: 391 IVGLVRASHCMSCNQSLWTNHHNQYV*PFRAQLFDNPR 278 +VG+V + MSC Q W H ++ P + L DN R Sbjct: 872 VVGVVCRTPVMSCPQDYWLCHASEECIPVQF-LCDNVR 908 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 24.6 bits (51), Expect = 3.4 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -3 Query: 718 LISSRKVSRVIFSECCSDTTTV*TLCGTVAPPANTYSQ 605 LI SR + R S S T T+CG +APP Q Sbjct: 450 LIGSRVIQRTPSS---SPPLTPNTICGLIAPPPQQQQQ 484 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +1 Query: 136 SSRQNVRPNKRRYSRRAPESGSGRKSC 216 +S + + P++R RR+P SG SC Sbjct: 245 ASIRKIPPSRRNPRRRSPRSGGRWPSC 271 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.8 bits (49), Expect = 5.9 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 130 RGSSRQNVRPNKRRYSRRAPESGSGRK 210 RGS R R R SR SGSG + Sbjct: 1158 RGSRRSRSRSRSRSGSRSRSRSGSGSR 1184 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 23.4 bits (48), Expect = 7.8 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -1 Query: 525 CVQALHQRHAFFCLICCITEHQALV 451 C +ALH C++C T HQ V Sbjct: 342 CHKALHLDIGLRCVVCDFTCHQQCV 366 >AY062190-1|AAL58551.1| 151|Anopheles gambiae cytochrome P450 CYP4H15 protein. Length = 151 Score = 23.4 bits (48), Expect = 7.8 Identities = 15/49 (30%), Positives = 29/49 (59%), Gaps = 5/49 (10%) Frame = +3 Query: 612 YVFAGGATVPQRVHTVVVSL----QHSEKITLETLRD-EIREKVIKEVI 743 Y + ATV QRV+ ++++ ++++T TL++ + E VIKE + Sbjct: 22 YYLSRDATVQQRVYDEILAIVGPDAKTQELTYGTLQELKYLEMVIKETL 70 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 896,557 Number of Sequences: 2352 Number of extensions: 20861 Number of successful extensions: 51 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79418373 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -