BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0623 (765 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 3.1 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 3.1 DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 23 4.1 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 23 4.1 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 23 4.1 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 23 4.1 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 7.2 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 9.5 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 21 9.5 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 21 9.5 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.0 bits (47), Expect = 3.1 Identities = 7/23 (30%), Positives = 15/23 (65%) Frame = +1 Query: 556 EMENFGGQDQIQKHRLLANMYLL 624 ++ ++ G++ + H+LL N Y L Sbjct: 250 DLPDYRGEEYLYSHKLLLNRYYL 272 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.0 bits (47), Expect = 3.1 Identities = 7/23 (30%), Positives = 15/23 (65%) Frame = +1 Query: 556 EMENFGGQDQIQKHRLLANMYLL 624 ++ ++ G++ + H+LL N Y L Sbjct: 250 DLPDYRGEEYLYSHKLLLNRYYL 272 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 22.6 bits (46), Expect = 4.1 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +2 Query: 509 CSACTQTQSENCRAQAKW 562 C CT+ Q +N A+W Sbjct: 75 CKKCTEIQKQNLDKLAEW 92 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 22.6 bits (46), Expect = 4.1 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +2 Query: 617 ICWWCNSPTESSYCSRVTATL*KDYPRDL 703 IC+ C T +S R+ L DY RD+ Sbjct: 24 ICFVCKDITSTSALYRLKLYLFCDYDRDI 52 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 22.6 bits (46), Expect = 4.1 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -2 Query: 104 ILIHLPYHNCVRWFSRIHSFLKSPAF 27 I+ HL H V W+S+ +F P + Sbjct: 173 IVFHLETHPNVTWYSQCVTFNAFPTY 198 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 22.6 bits (46), Expect = 4.1 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +2 Query: 509 CSACTQTQSENCRAQAKW 562 C CT+ Q +N A+W Sbjct: 75 CKKCTEIQKQNLDKLAEW 92 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.8 bits (44), Expect = 7.2 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -2 Query: 470 PNIKPWSPAPTSSSFLFSCTPAAMFGDCWSSASITLH 360 PN++P S +++ P M D W+S + LH Sbjct: 57 PNVRPISSHQIANNVTMQLLPKLMEFDDWTSV-MELH 92 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 763 PSRYCAGITSLMTFS 719 P+R G+TSL+T S Sbjct: 274 PARVTLGVTSLLTLS 288 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = -1 Query: 597 VFLNLVLPTKILHF 556 VFL+L++P IL+F Sbjct: 14 VFLSLLIPALILYF 27 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = +1 Query: 94 WISIFVHIGICWRGSSRQNVRPNKRR 171 W+ + V +GI +G + VR N R Sbjct: 4 WLLLVVCLGIACQGITSVTVRENSPR 29 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 229,753 Number of Sequences: 438 Number of extensions: 4996 Number of successful extensions: 17 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23911269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -