BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0622 (768 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 3.1 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 22 5.5 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 5.5 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 21 9.5 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 21 9.5 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 21 9.5 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 21 9.5 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +1 Query: 631 VLHSLVDKSNIKRQLEVYASGGD 699 +LH L +N Q+ + SGGD Sbjct: 1142 ILHGLKKYTNYSMQVLAFTSGGD 1164 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 22.2 bits (45), Expect = 5.5 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 339 YTKNYTTVTSMQESLED 389 YTK+ TV M E++ED Sbjct: 442 YTKDSYTVAGMGETIED 458 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.2 bits (45), Expect = 5.5 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +3 Query: 339 YTKNYTTVTSMQESLEDQN 395 Y KNYT S ++ L QN Sbjct: 446 YNKNYTKFCSTEKRLTKQN 464 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 9.5 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = +2 Query: 389 PKPEQRFHSFYNYCDLFNYILSVTPVPLELP 481 P+P F S F YI TP P +P Sbjct: 126 PRPMGPFVSMQEQIPRFRYIGPPTPFPRFIP 156 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 9.5 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = +2 Query: 389 PKPEQRFHSFYNYCDLFNYILSVTPVPLELP 481 P+P F S F YI TP P +P Sbjct: 126 PRPMGPFVSMQEQIPRFRYIGPPTPFPRFIP 156 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 9.5 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = +2 Query: 389 PKPEQRFHSFYNYCDLFNYILSVTPVPLELP 481 P+P F S F YI TP P +P Sbjct: 126 PRPMGPFVSMQEQIPRFRYIGPPTPFPRFIP 156 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.4 bits (43), Expect = 9.5 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = +2 Query: 389 PKPEQRFHSFYNYCDLFNYILSVTPVPLELP 481 P+P F S F YI TP P +P Sbjct: 126 PRPMGPFVSMQEQIPRFRYIGPPTPFPRFIP 156 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,735 Number of Sequences: 438 Number of extensions: 5137 Number of successful extensions: 14 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -