BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0621 (738 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 2e-21 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 64 1e-10 SB_17696| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 40 0.003 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.026 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 35 0.060 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 35 0.060 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 33 0.24 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 33 0.32 SB_30784| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 31 0.97 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 31 0.97 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 31 0.97 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 31 0.97 SB_26103| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_56851| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_49662| Best HMM Match : Bromodomain (HMM E-Value=9.8e-38) 29 3.9 SB_34248| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_52452| Best HMM Match : Borrelia_orfA (HMM E-Value=1.3) 29 3.9 SB_40323| Best HMM Match : zf-C3HC4 (HMM E-Value=0.42) 29 3.9 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_19996| Best HMM Match : PKD_channel (HMM E-Value=0) 29 5.2 SB_41386| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_38913| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_26183| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_9587| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_33329| Best HMM Match : Mak16 (HMM E-Value=0.15) 28 6.9 SB_11922| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_10759| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.9 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_50605| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.1 SB_38303| Best HMM Match : Fz (HMM E-Value=9.8e-07) 28 9.1 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 99 bits (238), Expect = 2e-21 Identities = 41/60 (68%), Positives = 55/60 (91%) Frame = +2 Query: 518 KTLAFLIPAIDLIYKLKFKPRNGTGVIILSPTRELSMQTFGVLMELMKYHHHTYGLVMGG 697 KTLAFL+P ++L+YKL+FK RNGTGVII+SPTRELS+QT+GV +L+K+H+ TYG++MGG Sbjct: 622 KTLAFLVPVVELLYKLQFKTRNGTGVIIISPTRELSLQTYGVARDLLKHHNFTYGIIMGG 681 Score = 77.4 bits (182), Expect = 1e-14 Identities = 48/118 (40%), Positives = 65/118 (55%), Gaps = 1/118 (0%) Frame = +3 Query: 171 KWKSSQKKIEKGXXXXXXXTS*SKI*GRSSDDSQDEQDTKE-DDSEKKSNNDLPGSSLCL 347 K KS K+ EK + K+ + + E+D+ D+E+ + LP + Sbjct: 510 KLKSKMKRSEKNKTEELVAVN--KVETDDDNPEETEEDSGNVSDTERTEESTLPSEA--- 564 Query: 348 GILSDQKFTALEGTVCEPTLLGIKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTALEK 521 + +F+AL V E TL GIKDMGF TMTEIQ K+I PLL+GRDL+GAAKT K Sbjct: 565 ALPDSHEFSALSEDVSEKTLQGIKDMGFTTMTEIQHKSIAPLLKGRDLLGAAKTGSGK 622 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 64.1 bits (149), Expect = 1e-10 Identities = 28/60 (46%), Positives = 44/60 (73%) Frame = +2 Query: 518 KTLAFLIPAIDLIYKLKFKPRNGTGVIILSPTRELSMQTFGVLMELMKYHHHTYGLVMGG 697 KTLAFLIP I+ +++ K+ +G G +++SPTREL+ QTF VL+++ H + GL++GG Sbjct: 100 KTLAFLIPIIETLWRQKWTSMDGLGALVISPTRELAYQTFEVLVKIGNKHDLSAGLIIGG 159 Score = 49.6 bits (113), Expect = 3e-06 Identities = 29/78 (37%), Positives = 43/78 (55%) Frame = +3 Query: 288 KEDDSEKKSNNDLPGSSLCLGILSDQKFTALEGTVCEPTLLGIKDMGFITMTEIQAKAIP 467 K D E++ DL +G +KF+ + + + TL G+ GF+T T+IQ + IP Sbjct: 25 KSWDKEQQEMKDLEDRCKEIGSSEVEKFS--DFPISKRTLDGLMKAGFVTPTDIQKQGIP 82 Query: 468 PLLEGRDLVGAAKTALEK 521 L GRD++GAAKT K Sbjct: 83 VALSGRDVLGAAKTGSGK 100 >SB_17696| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 41.1 bits (92), Expect = 0.001 Identities = 30/79 (37%), Positives = 43/79 (54%), Gaps = 4/79 (5%) Frame = +3 Query: 285 TKEDDSEKKSNNDLPGSS--LCLGILSDQKFTALEGTVCEPTLL-GIKDMGFITMTEIQA 455 T+++ EK+ +D G S G L D + EG P +L + D GF T IQ+ Sbjct: 43 TQQESQEKEKGSDAEGLSNQKVQGSLIDM--SEWEGLGVAPDILRALGDQGFSKPTPIQS 100 Query: 456 KAIPP-LLEGRDLVGAAKT 509 +IPP LL RD++GAA+T Sbjct: 101 LSIPPALLYHRDIIGAAET 119 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 39.9 bits (89), Expect = 0.002 Identities = 31/83 (37%), Positives = 42/83 (50%), Gaps = 4/83 (4%) Frame = +3 Query: 285 TKEDDSEKKSNNDLPGSS--LCLGILSDQKFTALEGTVCEPTLL-GIKDMGFITMTEIQA 455 T+++ EK+ D G S G L D EG P +L + D GF T IQ+ Sbjct: 101 TQQETQEKEKGGDAEGLSNQKVKGSLIDMP--EWEGLGVAPDILRALGDQGFSKPTPIQS 158 Query: 456 KAIPP-LLEGRDLVGAAKTALEK 521 +IPP LL RD++GAA+T K Sbjct: 159 LSIPPALLYHRDIIGAAETGSGK 181 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +2 Query: 596 IILSPTRELSMQTFGVLMELMKYHHHTYGLVMGG 697 +I++PTREL++Q L++ KY ++GG Sbjct: 222 LIMAPTRELALQVKDHLVKAAKYTSVKVAAIVGG 255 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/33 (51%), Positives = 21/33 (63%) Frame = +3 Query: 423 MGFITMTEIQAKAIPPLLEGRDLVGAAKTALEK 521 MG TEIQ +PP+L+GRD +G AKT K Sbjct: 25 MGIKKPTEIQLNCVPPILQGRDCIGCAKTGSGK 57 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/64 (37%), Positives = 36/64 (56%) Frame = +2 Query: 518 KTLAFLIPAIDLIYKLKFKPRNGTGVIILSPTRELSMQTFGVLMELMKYHHHTYGLVMGG 697 KT AFLIP + + K G +ILSPTREL++QT + EL ++ +++GG Sbjct: 331 KTAAFLIPMFEKLQTHTAKV--GIRALILSPTRELALQTQKFIKELGRFTGLKSSVILGG 388 Query: 698 ATEV 709 + V Sbjct: 389 DSVV 392 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 36.3 bits (80), Expect = 0.026 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = +3 Query: 396 EPTLLGIKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTALEK 521 E + I+ + + T+IQ +A+P L GRD++G AKT K Sbjct: 526 EQMMASIRKLEYTQPTQIQCQALPIALSGRDIIGIAKTGSGK 567 Score = 31.5 bits (68), Expect = 0.74 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +2 Query: 518 KTLAFLIPA-IDLIYKLKFKPRNGTGVIILSPTRELSMQTFGVLMELMK-YHHHTYGLVM 691 KT AFL PA + ++ + + + +G V+I +PTREL Q + K Y+ H + Sbjct: 567 KTAAFLWPALVHIMDQPELQVGDGPIVLICAPTRELCQQIYTEARRFGKAYNIHVVAVFG 626 Query: 692 GG 697 GG Sbjct: 627 GG 628 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 35.1 bits (77), Expect = 0.060 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 3/72 (4%) Frame = +2 Query: 518 KTLAFLIPAIDLIYKLKFKPRNGTGVIILSPTRELSMQTFGVLMELMKYHHHTYGLVMGG 697 KT A+L+P ++ K N ++L PTREL++QT + +EL K+ + GG Sbjct: 97 KTAAYLVPLLERTDTTK----NCIQALVLVPTRELALQTSQICIELGKHMGAQVMVTTGG 152 Query: 698 AT---EVLKLRN 724 + ++L+L N Sbjct: 153 TSLKDDILRLYN 164 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +3 Query: 405 LLGIKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTALEK 521 L+GI + GF + IQ ++IP L GRD++ AK K Sbjct: 59 LMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGK 97 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 35.1 bits (77), Expect = 0.060 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 3/72 (4%) Frame = +2 Query: 518 KTLAFLIPAIDLIYKLKFKPRNGTGVIILSPTRELSMQTFGVLMELMKYHHHTYGLVMGG 697 KT A+L+P ++ K N ++L PTREL++QT + +EL K+ + GG Sbjct: 97 KTAAYLVPLLERTDTTK----NCIQALVLVPTRELALQTSQICIELGKHMGAQVMVTTGG 152 Query: 698 AT---EVLKLRN 724 + ++L+L N Sbjct: 153 TSLKDDILRLYN 164 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/39 (41%), Positives = 23/39 (58%) Frame = +3 Query: 405 LLGIKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTALEK 521 L+GI + GF + IQ ++IP L GRD++ AK K Sbjct: 59 LMGIFEKGFDKPSPIQEESIPVALAGRDILARAKNGTGK 97 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 33.1 bits (72), Expect = 0.24 Identities = 18/55 (32%), Positives = 26/55 (47%) Frame = +3 Query: 357 SDQKFTALEGTVCEPTLLGIKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTALEK 521 SD+ A + E + ++GF+ T IQA IP L G+D+ A T K Sbjct: 6 SDEVLNAYDSLDEEAEDRAVNELGFLHPTPIQASTIPVALMGKDVCACAATGTGK 60 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/39 (38%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = +2 Query: 518 KTLAFLIPAID-LIYKLKFKPRNGTGVIILSPTRELSMQ 631 KT AF++P ++ L+Y+ P V++++PTREL++Q Sbjct: 60 KTAAFMLPILERLLYRPTQSP--AIRVLVITPTRELAIQ 96 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 32.7 bits (71), Expect = 0.32 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 2/62 (3%) Frame = +2 Query: 518 KTLAFLIPAIDLIYKLKFKPRNGTG--VIILSPTRELSMQTFGVLMELMKYHHHTYGLVM 691 KTL+F +P ++ + K + G V++++PTREL+ Q G E +K + Y + Sbjct: 123 KTLSFALPLVEKLQDGKLSQKRGRAPKVLVMAPTRELAKQV-GNEFENLKSNLEVY-CIY 180 Query: 692 GG 697 GG Sbjct: 181 GG 182 Score = 30.3 bits (65), Expect = 1.7 Identities = 27/126 (21%), Positives = 53/126 (42%) Frame = +3 Query: 144 EESCTRR*HKWKSSQKKIEKGXXXXXXXTS*SKI*GRSSDDSQDEQDTKEDDSEKKSNND 323 E+ +R+ + K +K+I K T K+ + S + Q E K+ + K + Sbjct: 3 EKKKSRKDKEVKDEEKEIRKSKEKVEKKTKKRKL--KESAEEQPEVSKKKRKTAKDESEF 60 Query: 324 LPGSSLCLGILSDQKFTALEGTVCEPTLLGIKDMGFITMTEIQAKAIPPLLEGRDLVGAA 503 G + + F+ + + T+ ++D G + IQA + +G D++G A Sbjct: 61 DEGVEPSVA-QREGDFSKFR--ISQKTIDNLEDRGITYLFPIQASTFNYIYDGEDVIGQA 117 Query: 504 KTALEK 521 +T K Sbjct: 118 RTGTGK 123 >SB_30784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 32.7 bits (71), Expect = 0.32 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = +3 Query: 261 DDSQDEQDTKEDDSEKKSNNDLPGSSLCLGILSDQKFTALE 383 DD D+ D +DD + N+D+P S+ G+ + F +++ Sbjct: 22 DDDDDDDDDDDDDDDDDDNDDVPSGSVMHGLPFARNFPSVQ 62 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 31.9 bits (69), Expect = 0.56 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 3/75 (4%) Frame = +2 Query: 518 KTLAFLIPAIDLIYKLKFKPRNGTG---VIILSPTRELSMQTFGVLMELMKYHHHTYGLV 688 KT F I + I +K +NG ++L+PTREL+ Q V++ L Y H Sbjct: 135 KTATFAISILQEI-DTNYKDKNGCDCCQALVLAPTRELAQQIQKVVLALGDYMHVKCHAC 193 Query: 689 MGGATEVLKLRNSLK 733 +GG T V + R L+ Sbjct: 194 IGG-TNVREDRMKLE 207 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 31.1 bits (67), Expect = 0.97 Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = +3 Query: 402 TLLGIKD-MGFITMTEIQAKAIPPLLEGRDLVGAAKTALEK 521 ++L I D +G+ T IQ +AIP L+ RD++G A+T K Sbjct: 111 SILEIVDKLGYKDPTPIQRQAIPIGLQNRDIIGVAETGSGK 151 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 31.1 bits (67), Expect = 0.97 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +2 Query: 518 KTLAFLIPAIDLIY-KLKFKPRNGTGVIILSPTRELSMQTFGVLMELM 658 KTLA+ +P L+ K P + +IL+PTREL Q F + E++ Sbjct: 122 KTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTRELMQQVFMNVSEML 169 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 31.1 bits (67), Expect = 0.97 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +3 Query: 399 PTLL-GIKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTALEK 521 PTLL G+ + GF + IQ KAIP G DL+ AK+ K Sbjct: 22 PTLLRGLNEAGFEKPSPIQLKAIPLGRCGLDLIAQAKSGTGK 63 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 31.1 bits (67), Expect = 0.97 Identities = 20/65 (30%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Frame = +2 Query: 530 FLIPAIDLI-YKLKFKPRNGTGVIILSPTRELSMQTFGVLMELMKYHHHTYGLVMGGATE 706 F++P I I ++ +P +G V++L PTREL+ Q V + K+ + GGA + Sbjct: 113 FILPGIVHINHQPLLQPGDGPIVLVLCPTRELAQQVQEVAYSVGKHCKLRSTCIYGGAPK 172 Query: 707 VLKLR 721 ++R Sbjct: 173 GPQIR 177 >SB_26103| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1176 Score = 30.7 bits (66), Expect = 1.3 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -1 Query: 666 WYFINSMRTPNVCIDNSLVGDKMMTPVPFLGLNFNLYIRSI 544 WY + SM+TP +L+G K++ G FN +RS+ Sbjct: 1014 WYTLPSMKTPRCNFAGALIGRKLIVAGGGDGFYFNSALRSV 1054 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 426 GFITMTEIQAKAIPPLLEGRDLVGAAKTALEK 521 GF + IQ +AI P+L+GRD++ A++ K Sbjct: 16 GFEKPSAIQQRAIKPILKGRDVIAQAQSGTGK 47 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +3 Query: 396 EPTLLGIKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTALEK 521 E + I G+ T +Q A+P ++ GRDL+ A+T K Sbjct: 488 EQLMANISRAGYRRPTPVQKAALPIVMAGRDLMACAQTGSGK 529 >SB_56851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 29.5 bits (63), Expect = 3.0 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 249 GRSSDDSQDEQDTKEDDSEKKSNND 323 G S DD D+ D +DD + K N+D Sbjct: 45 GGSDDDDNDDNDDDDDDYDDKDNDD 69 >SB_49662| Best HMM Match : Bromodomain (HMM E-Value=9.8e-38) Length = 1301 Score = 29.1 bits (62), Expect = 3.9 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 3/50 (6%) Frame = +3 Query: 171 KWKSSQKKIEKGXXXXXXXTS*---SKI*GRSSDDSQDEQDTKEDDSEKK 311 K K QKK +KG +S S SS + E+DT+E++SEKK Sbjct: 102 KKKRKQKKKQKGKKKKRVSSSSESESDFITSSSSEESSEEDTEEENSEKK 151 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 255 SSDDSQDEQDTKEDDSEKKSNNDLPGS 335 SSDD+ DE +D EK+ LP S Sbjct: 321 SSDDNNDENSKDREDLEKRERKPLPPS 347 >SB_34248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/54 (22%), Positives = 25/54 (46%) Frame = +2 Query: 545 IDLIYKLKFKPRNGTGVIILSPTRELSMQTFGVLMELMKYHHHTYGLVMGGATE 706 +++I ++ +P NG L+P S+Q+F ++++ Y V E Sbjct: 119 LNVIQRMNLRPLNGMQTTSLAPRVFASLQSFAYFRYMLRHREELYTFVQAAEAE 172 >SB_52452| Best HMM Match : Borrelia_orfA (HMM E-Value=1.3) Length = 471 Score = 29.1 bits (62), Expect = 3.9 Identities = 32/131 (24%), Positives = 57/131 (43%), Gaps = 2/131 (1%) Frame = +3 Query: 132 KRS*EESCTRR*HKWKSSQKKIEKGXXXXXXXT-S*SKI*GRSSDDSQDEQDTKEDDSEK 308 K++ +E+ T++ K KK +K T + S I +S +DS+DE+ + +K Sbjct: 244 KQNFDENTTKQESGCKPKNKKRKKKKEKKTNETDNESSIKKKSCEDSEDEEHLPSKEKKK 303 Query: 309 KSNNDLPGSSLCLGILSDQK-FTALEGTVCEPTLLGIKDMGFITMTEIQAKAIPPLLEGR 485 K S G + K A GT +LL + + + Q + + + E + Sbjct: 304 KRKKSKDSSE---GYIKQSKDIIAETGT----SLLKCSEKKILKEAKRQKRKLKDINEAQ 356 Query: 486 DLVGAAKTALE 518 D +GA AL+ Sbjct: 357 DELGAEINALQ 367 >SB_40323| Best HMM Match : zf-C3HC4 (HMM E-Value=0.42) Length = 495 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/54 (22%), Positives = 25/54 (46%) Frame = +2 Query: 545 IDLIYKLKFKPRNGTGVIILSPTRELSMQTFGVLMELMKYHHHTYGLVMGGATE 706 +++I ++ +P NG L+P S+Q+F ++++ Y V E Sbjct: 410 LNVIQRMNLRPLNGMQTTSLAPRVFASLQSFAYFRYMLRHREELYTFVQAAEAE 463 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 28.7 bits (61), Expect = 5.2 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 414 IKDMGFITMTEIQAKAIPPLLEGRDLVGAAKT 509 +K + T IQA+AIP ++ GRD++ T Sbjct: 120 LKKNSYEKPTPIQAQAIPVIMSGRDMIAIVMT 151 >SB_19996| Best HMM Match : PKD_channel (HMM E-Value=0) Length = 746 Score = 28.7 bits (61), Expect = 5.2 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 255 SSDDSQDEQDTKEDDSEKKSNND 323 S DD D+ D DDSE +ND Sbjct: 509 SDDDDDDDDDDDSDDSEDNDSND 531 >SB_41386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 28.3 bits (60), Expect = 6.9 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +3 Query: 252 RSSDDSQDEQDTKEDDSEKKSNNDL 326 +S + S ++++ EDD E+K N DL Sbjct: 88 KSEESSLEDEEDDEDDEEEKENTDL 112 >SB_38913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 28.3 bits (60), Expect = 6.9 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 261 DDSQDEQDTKEDDSEKKSNND 323 DD D+ D ++DD ++ NND Sbjct: 22 DDDNDDDDDEDDDDDEDDNND 42 >SB_26183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 28.3 bits (60), Expect = 6.9 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 237 SKI*GRSSDDSQDEQDTKEDDSEKKSNNDL 326 S + GR DD D+ D +DD + ++D+ Sbjct: 8 SNLYGRDDDDDDDDDDDDDDDDDDDDDDDV 37 >SB_9587| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +3 Query: 249 GRSSDDSQDEQDTKEDDSEKKSNNDLPGSSLCLG 350 G +D D DDS+ K NND + C G Sbjct: 111 GNDNDSGSKRNDDDYDDSDSKRNNDDDSGTKCNG 144 >SB_33329| Best HMM Match : Mak16 (HMM E-Value=0.15) Length = 265 Score = 28.3 bits (60), Expect = 6.9 Identities = 9/27 (33%), Positives = 19/27 (70%) Frame = +3 Query: 252 RSSDDSQDEQDTKEDDSEKKSNNDLPG 332 + +DD DE++ ++DD E++ ++D G Sbjct: 108 QGNDDDDDEEEEEDDDDEEEEDDDEDG 134 >SB_11922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +3 Query: 249 GRSSDDSQDEQDTKEDDSEKKSNNDLPGSSLCLG 350 G +D D DDS+ K NND + C G Sbjct: 50 GNDNDSGSKRNDDDYDDSDSKRNNDDDSGTKCNG 83 >SB_10759| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 316 Score = 28.3 bits (60), Expect = 6.9 Identities = 15/51 (29%), Positives = 22/51 (43%) Frame = +3 Query: 252 RSSDDSQDEQDTKEDDSEKKSNNDLPGSSLCLGILSDQKFTALEGTVCEPT 404 + DD++ + D +DD EK+ DL L + DQ EPT Sbjct: 41 KDDDDAEADDDDSDDDFEKEMEMDLDAVMLRHSVCEDQSTNPTRNPT-EPT 90 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 27.9 bits (59), Expect = 9.1 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +3 Query: 261 DDSQDEQDTKEDDSEKKSNNDLP 329 DD D+ D +DD + NN +P Sbjct: 759 DDDDDDDDDDDDDDDDDDNNSIP 781 >SB_50605| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 377 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/39 (28%), Positives = 19/39 (48%) Frame = +3 Query: 252 RSSDDSQDEQDTKEDDSEKKSNNDLPGSSLCLGILSDQK 368 + DD D+ D + D+ NND G S + ++ + K Sbjct: 315 KDDDDENDDDDENDADTVDDGNNDRDGDSDGVSVVDNNK 353 >SB_38303| Best HMM Match : Fz (HMM E-Value=9.8e-07) Length = 528 Score = 27.9 bits (59), Expect = 9.1 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 252 RSSDDSQDEQDTKEDDSE 305 + DDS DE DTK DD + Sbjct: 441 KDDDDSDDESDTKNDDDD 458 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,538,136 Number of Sequences: 59808 Number of extensions: 347555 Number of successful extensions: 4005 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 1503 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3579 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1986074805 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -