BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0621 (738 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 34 0.001 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 3.0 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 23 4.0 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 6.9 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 22 6.9 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 9.1 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 9.1 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 9.1 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 34.3 bits (75), Expect = 0.001 Identities = 19/67 (28%), Positives = 33/67 (49%) Frame = +3 Query: 414 IKDMGFITMTEIQAKAIPPLLEGRDLVGAAKTALEKH*HS*YRXXXXXXXXXXXQEMVLE 593 IK G+ T +Q A+P ++ GRDL+ A+T K + + ++V+ Sbjct: 211 IKKSGYKKPTPVQKHALPIIMNGRDLMACAQTGSGK--TAAFAVPIINTLLERSVDLVVT 268 Query: 594 SSFCHPQ 614 S++C PQ Sbjct: 269 STYCEPQ 275 Score = 25.8 bits (54), Expect = 0.42 Identities = 16/48 (33%), Positives = 29/48 (60%), Gaps = 2/48 (4%) Frame = +2 Query: 593 VIILSPTRELSMQTFGVLMELMKYHHHTY--GLVMGGATEVLKLRNSL 730 V+I+SPTREL++Q + +++K+ ++ +V G T V+ R L Sbjct: 276 VVIVSPTRELTIQ---IWQQIVKFSLNSILKTVVAYGGTSVMHQRGKL 320 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.0 bits (47), Expect = 3.0 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = -1 Query: 702 VAPPITRPYVWWWYFINSMRTPNVC 628 + PPI P+ + MRT VC Sbjct: 608 IVPPIIEPFTFQEGLSEGMRTRTVC 632 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.6 bits (46), Expect = 4.0 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +1 Query: 76 QKTDSNPEPEKDIEALNNEKEAK--KRVVQDGDTN 174 +K + NP+P+ + ALN K K V Q G T+ Sbjct: 26 KKRNKNPQPKNAVCALNELKSGAVYKVVDQTGPTH 60 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.8 bits (44), Expect = 6.9 Identities = 7/24 (29%), Positives = 14/24 (58%) Frame = -3 Query: 418 LIPKRVGSHTVPSSAVNF*SDSIP 347 L+P+ + HT P S + + ++P Sbjct: 653 LLPRPISCHTTPDSFIEAPNKTLP 676 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.8 bits (44), Expect = 6.9 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +2 Query: 302 GKKIEQRFTWIKPLLRYTIRSKIHCT 379 GKKI F ++PL+ + S ++ T Sbjct: 240 GKKITHFFDLVRPLIAFKFHSILNRT 265 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/31 (25%), Positives = 13/31 (41%) Frame = -1 Query: 669 WWYFINSMRTPNVCIDNSLVGDKMMTPVPFL 577 WW ++ TP +C+ PV +L Sbjct: 490 WWKICWTITTPAICVGVFTFNIIKFVPVKYL 520 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/31 (25%), Positives = 13/31 (41%) Frame = -1 Query: 669 WWYFINSMRTPNVCIDNSLVGDKMMTPVPFL 577 WW ++ TP +C+ PV +L Sbjct: 543 WWKICWTITTPAICVGVFTFNIIKFVPVKYL 573 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 9.1 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +1 Query: 664 PPPYIWSGNG 693 PPP +W NG Sbjct: 339 PPPLVWRRNG 348 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,597 Number of Sequences: 438 Number of extensions: 3060 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -