BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0620 (769 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 2.4 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 23 4.1 AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 22 7.2 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 9.5 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 762 NYQLIPYKTYKKPTG 718 N+QLI Y YK P G Sbjct: 187 NHQLISYAGYKNPDG 201 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 22.6 bits (46), Expect = 4.1 Identities = 12/54 (22%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = -1 Query: 469 SLSCLRVTLEWQG*RGWRVMRLSRPSSLLCTTSWYPHSRSPLRV-YRLSLGALS 311 + +C+++ + G+ + PS+L+ SW P + R++LG S Sbjct: 199 NFTCIQIVFNLRRRLGYHLFHTYIPSALIVVMSWIAFWIKPEAIPARVTLGVTS 252 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 21.8 bits (44), Expect = 7.2 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = +2 Query: 218 IVSDLQPQLLGKGPTTVRLQTAAPP 292 I +Q ++ P+T++++ APP Sbjct: 84 IADRMQKEITALAPSTMKIKIIAPP 108 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.4 bits (43), Expect = 9.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -3 Query: 140 YHRRFVCGLRN*GIPLLCNRCLPFRGSPGRIRQP 39 +++ F+ +R G+P N G+ GR+ QP Sbjct: 78 HNKTFLAVIRYNGVPSSLNVVSDKTGNGGRLLQP 111 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 220,593 Number of Sequences: 438 Number of extensions: 5095 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -