BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0616 (478 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0234 - 6116931-6117052,6117549-6118369,6118573-6118601,611... 27 5.9 10_06_0120 - 10979458-10979665,10979909-10980585,10981315-109815... 27 7.8 >09_02_0234 - 6116931-6117052,6117549-6118369,6118573-6118601, 6118711-6119020,6119469-6119476,6120104-6120232, 6120341-6120445 Length = 507 Score = 27.5 bits (58), Expect = 5.9 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +2 Query: 149 TPDGEWSPSLIEFQIFKKKDYFYAHQSYFRIKLK*CFYNFVCDKF 283 T G++ +L + I K +DY Y RIK+K CD F Sbjct: 414 TDAGQFRKALKSYHIVKGRDYKYTRNKADRIKVKCSQDKVKCDFF 458 >10_06_0120 - 10979458-10979665,10979909-10980585,10981315-10981538, 10981763-10982136,10982203-10982786 Length = 688 Score = 27.1 bits (57), Expect = 7.8 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +2 Query: 134 RRAYGTPDGEWSPSLIEF-QIFKKKDYFYAHQSYFRIKLK 250 RR G PD SL+EF Q F +K+ Y+R +K Sbjct: 336 RRIPGQPDSSKKDSLVEFMQNFLEKETMMPRNRYWRTPVK 375 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,665,307 Number of Sequences: 37544 Number of extensions: 177634 Number of successful extensions: 327 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 327 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 979080328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -