BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0616 (478 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z48621-1|CAA88540.2| 179|Caenorhabditis elegans Hypothetical pr... 27 5.3 AF068709-15|AAC19246.2| 317|Caenorhabditis elegans Serpentine r... 27 7.0 >Z48621-1|CAA88540.2| 179|Caenorhabditis elegans Hypothetical protein R07B1.2 protein. Length = 179 Score = 27.5 bits (58), Expect = 5.3 Identities = 12/33 (36%), Positives = 16/33 (48%), Gaps = 4/33 (12%) Frame = +2 Query: 155 DGEWSPSLIEFQIFKKKDYF----YAHQSYFRI 241 +GEW P L K+ D F Y H+ Y+ I Sbjct: 70 NGEWGPQLRHSHFLKRHDPFHVRIYVHEGYYNI 102 >AF068709-15|AAC19246.2| 317|Caenorhabditis elegans Serpentine receptor, class g (gamma)protein 62 protein. Length = 317 Score = 27.1 bits (57), Expect = 7.0 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 322 ITLIHFKFQYQKIWFTFGKFIALVVC 399 +T I F +QY+ W + + LVVC Sbjct: 125 LTSILFPYQYENFWSRWNLLVFLVVC 150 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,246,009 Number of Sequences: 27780 Number of extensions: 192344 Number of successful extensions: 388 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 385 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 388 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 871571276 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -