BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= e40h0615 (776 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC364.07 ||SPCC4G3.01|D-3 phosphoglycerate dehydrogenase |Schi... 40 3e-04 SPAC343.19 ||SPAC824.01|phosphatidylinositol 4-kinase Lsb6 |Schi... 26 6.9 >SPCC364.07 ||SPCC4G3.01|D-3 phosphoglycerate dehydrogenase |Schizosaccharomyces pombe|chr 3|||Manual Length = 466 Score = 40.3 bits (90), Expect = 3e-04 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = +3 Query: 18 TLEIIQQPAVIATPHLGASTKEAQVRVGQEIAEQLVNLVKPG 143 T E+ +I TPH+G ST+EAQ +G E++E L + G Sbjct: 330 TSELTHCKNIILTPHIGGSTEEAQYNIGIEVSEALTRYINEG 371 >SPAC343.19 ||SPAC824.01|phosphatidylinositol 4-kinase Lsb6 |Schizosaccharomyces pombe|chr 1|||Manual Length = 624 Score = 25.8 bits (54), Expect = 6.9 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -3 Query: 168 LRPAESGMFPASPGSRAAQQSPGQ 97 L P+ S FP PGS+ Q +PG+ Sbjct: 553 LHPSCSQTFPPYPGSQLLQATPGR 576 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,157,130 Number of Sequences: 5004 Number of extensions: 31608 Number of successful extensions: 61 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 375345278 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -